![Immunohistochemistry-Paraffin: Carboxypeptidase A2/CPA2 Antibody [NBP1-87555] - Staining of human testis.](http://images.novusbio.com/fullsize/Carboxypeptidase-A2-CPA2-Antibody-Immunohistochemistry-Paraffin-NBP1-87555-img0009.jpg "Immunohistochemistry-Paraffin: Carboxypeptidase A2/CPA2 Antibody [NBP1-87555] - Staining of human testis.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LETFVGDQVLEIVPSNEEQIKNLLQLEAQEHLQLDFWKSPTTPGETAHVRVPFVNVQAVKVFLESQGIAYSI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CPA2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot RFC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RFC1_AF6457_Western_Blot_9874.jpg)
![Carboxypeptidase A4/CPA4 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Carboxypeptidase A4/CPA4 [Unconjugated]")
![Flow Cytometry NHA2/SLC9B2/NHEDC2 Antibody (896151) [Unconjugated]](https://images.novusbio.com/images2/NHA2_MAB8404_Flow_Cytometry_16664.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CPA2 |
![Immunohistochemistry-Paraffin: Carboxypeptidase A2/CPA2 Antibody [NBP1-87555] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize/Carboxypeptidase-A2-CPA2-Antibody-Immunohistochemistry-Paraffin-NBP1-87555-img0004.jpg "Immunohistochemistry-Paraffin: Carboxypeptidase A2/CPA2 Antibody [NBP1-87555] - Staining of human liver shows low expression as expected.")
![Immunohistochemistry-Paraffin: Carboxypeptidase A2/CPA2 Antibody [NBP1-87555] - Staining of human pancreas shows high expression.](http://images.novusbio.com/fullsize/Carboxypeptidase-A2-CPA2-Antibody-Immunohistochemistry-Paraffin-NBP1-87555-img0005.jpg "Immunohistochemistry-Paraffin: Carboxypeptidase A2/CPA2 Antibody [NBP1-87555] - Staining of human pancreas shows high expression.")
![Immunohistochemistry-Paraffin: Carboxypeptidase A2/CPA2 Antibody [NBP1-87555] - Staining in human pancreas and liver tissues using anti-CPA2 antibody. Corresponding CPA2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Carboxypeptidase-A2-CPA2-Antibody-Immunohistochemistry-Paraffin-NBP1-87555-img0006.jpg "Immunohistochemistry-Paraffin: Carboxypeptidase A2/CPA2 Antibody [NBP1-87555] - Staining in human pancreas and liver tissues using anti-CPA2 antibody. Corresponding CPA2 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Carboxypeptidase A2/CPA2 Antibody [NBP1-87555] - Staining of human kidney, liver, pancreas and testis using Anti-CPA2 antibody NBP1-87555 (A) shows similar protein distribution across tissues to independent antibody NBP1-86028 (B).](http://images.novusbio.com/fullsize/Carboxypeptidase-A2-CPA2-Antibody-Immunohistochemistry-Paraffin-NBP1-87555-img0007.jpg "Immunohistochemistry-Paraffin: Carboxypeptidase A2/CPA2 Antibody [NBP1-87555] - Staining of human kidney, liver, pancreas and testis using Anti-CPA2 antibody NBP1-87555 (A) shows similar protein distribution across tissues to independent antibody NBP1-86028 (B).")
![Immunohistochemistry-Paraffin: Carboxypeptidase A2/CPA2 Antibody [NBP1-87555] - Staining of human kidney.](http://images.novusbio.com/fullsize/Carboxypeptidase-A2-CPA2-Antibody-Immunohistochemistry-Paraffin-NBP1-87555-img0008.jpg "Immunohistochemistry-Paraffin: Carboxypeptidase A2/CPA2 Antibody [NBP1-87555] - Staining of human kidney.")
![Western Blot RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Western_Blot_10216.jpg)
![Immunocytochemistry RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Immunocytochemistry_10464.jpg)
![Simple Western RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Simple_Western_16629.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")