Home » Carbonic Anhydrase X/CA10 » Carbonic Anhydrase X/CA10 Proteins » Carbonic Anhydrase X/CA10 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Carbonic Anhydrase X/CA10 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Carbonic Anhydrase X/CA10 Recombinant Protein Antigen (NBP2-55638PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Carbonic Anhydrase X/CA10 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Carbonic Anhydrase X/CA10.

Source: E. coli

Amino Acid Sequence: PSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CA10
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55638.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Carbonic Anhydrase X/CA10 Recombinant Protein Antigen

  • CA10
  • Carbonic Anhydrase X
  • carbonic anhydrase-related protein 10
  • Carbonic anhydrase-related protein X
  • CARP X
  • CARPX
  • CA-RPX
  • CARPXCA-RP X
  • Cerebral protein 15
  • cerebral protein-15
  • HUCEP-15

Background

CA10 encodes a protein that belongs to the carbonic anhydrase family of zinc metalloenzymes, which catalyze the reversible hydration of carbon dioxide in various biological processes. The protein encoded by this gene is an acatalytic member of the alpha-carbonic anhydrase subgroup, and it is thought to play a role in the central nervous system, especially in brain development. Multiple transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CA11
Overexpression Lysate
NBL1-08611
Western Blot CA11 Overexpression Lysate
Species: Hu
Applications: WB
Bag-1 Antibody
NB100-56082
Immunohistochemistry-Paraffin Bag-1 Antibody
Immunohistochemistry-Paraffin Bag-1 Antibody
Western Blot Bag-1 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
RAR beta/NR1B2
Antibody (336)
NB200-323
Western Blot RAR beta/NR1B2 Antibody (336)
(2 Reviews)
(1 Publication)
Species: Hu, Rt
Applications: WB
RTN3 Antibody
NBP1-88871
Immunocytochemistry/ Immunofluorescence RTN3 Antibody
Immunohistochemistry-Paraffin RTN3 Antibody
Immunohistochemistry-Paraffin RTN3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
SAFB Antibody
NB100-2593
Immunohistochemistry SAFB Antibody
Immunohistochemistry-Paraffin SAFB Antibody
Immunohistochemistry-Paraffin SAFB Antibody
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Calcium-sensing
R/CaSR Antibody (5C10 ...
NB120-19347
Western Blot Calcium-sensing R/CaSR Antibody (5C10, ADD) - BSA Free
Immunocytochemistry/ Immunofluorescence Calcium-sensing R/CaSR Antibody (5C10, ADD) - BSA Free
Immunocytochemistry/ Immunofluorescence Calcium-sensing R/CaSR Antibody (5C10, ADD) - BSA Free
(1 Review)
(21 Publications)
Species: Bv, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Carbonic Anhydrase
VIII/CA8 Antibody [Un ...
AF2187
Western Blot Carbonic Anhydrase VIII/CA8 Antibody [Unconjugated]
Simple Western Carbonic Anhydrase VIII/CA8 Antibody [Unconjugated]
Species: Hu, Mu
Applications: IP, Simple Western, WB
Gastrokine 1
Antibody
AF7287
Immunohistochemistry Gastrokine 1 Antibody
Immunohistochemistry Gastrokine 1 Antibody
Western Blot Gastrokine 1 Antibody
(2 Publications)
Species: Hu, Mu
Applications: IHC, WB
Ferredoxin
Reductase Antibody
NBP2-38530
Western Blot Ferredoxin Reductase Antibody
Immunohistochemistry-Paraffin Ferredoxin Reductase Antibody
Immunohistochemistry-Paraffin Ferredoxin Reductase Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
SPINK1 Antibody
(4D4)
H00006690-M01
Western Blot SPINK1 Antibody (4D4)
Immunohistochemistry SPINK1 Antibody (4D4)
Immunohistochemistry SPINK1 Antibody (4D4)
(1 Review)
(32 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Protein Kinase A
regulatory subunit I ...
NBP1-47935
Immunohistochemistry-Paraffin Protein Kinase A regulatory subunit I alpha Antibody (OTI6C7)
Western Blot Protein Kinase A regulatory subunit I alpha Antibody (OTI6C7)
Immunohistochemistry-Paraffin Protein Kinase A regulatory subunit I alpha Antibody (OTI6C7)
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
CAR/NR1I3 Antibody
(N4111) [Unconjugated ...
PP-N4111-00
CAR/NR1I3 Antibody (N4111) [Unconjugated]
(8 Publications)
Species: Hu
Applications: IHC, IP, WB
SPG7 Antibody
(OTI1C1)
NBP2-01860
Western Blot SPG7 Antibody (OTI1C1)
Flow Cytometry SPG7 Antibody (OTI1C1)
Flow Cytometry SPG7 Antibody (OTI1C1)
(1 Review)
(3 Publications)
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Arrestin 3 Antibody
NBP1-37003
Immunohistochemistry-Paraffin Arrestin 3 Antibody
Immunohistochemistry-Paraffin Arrestin 3 Antibody
(9 Publications)
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
CXADR Antibody
[Unconjugated]
AF2654
Western Blot CXADR Antibody [Unconjugated]
Simple Western CXADR Antibody [Unconjugated]
(6 Publications)
Species: Mu
Applications: IHC, Simple Western, WB
Carbonic Anhydrase
X/CA10 Recombinant Pr ...
NBP2-55638PEP
Carbonic Anhydrase X/CA10 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Carbonic Anhydrase X/CA10 Recombinant Protein Antigen (NBP2-55638PEP) (0)

There are no publications for Carbonic Anhydrase X/CA10 Recombinant Protein Antigen (NBP2-55638PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carbonic Anhydrase X/CA10 Recombinant Protein Antigen (NBP2-55638PEP) (0)

There are no reviews for Carbonic Anhydrase X/CA10 Recombinant Protein Antigen (NBP2-55638PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Carbonic Anhydrase X/CA10 Recombinant Protein Antigen (NBP2-55638PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Carbonic Anhydrase X/CA10 Products

Blogs on Carbonic Anhydrase X/CA10

There are no specific blogs for Carbonic Anhydrase X/CA10, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western Blot: SPINK1 Antibody (4D4) [H00006690-M01] - Detection against Immunogen (31.9 kDa). Antibody reactive against recombinant protein.
SPINK1 Antibody (4D4)
H00006690-M01
Western Blot: Calcium-sensing R/CaSR Antibody (5C10, ADD) [NB120-19347] - Total protein from human Hek293 and rat Pancreas was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-CaSR in block buffer and detected with an anti-mouse HRP secondary antibody using West Pico PLUS chemiluminescence detection reagent.
Calcium-sensing R/CaSR Antibody (5C10, ADD) - BSA Free
NB120-19347

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Carbonic Anhydrase X/CA10 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CA10