Home » Carbonic Anhydrase I/CA1 » Carbonic Anhydrase I/CA1 Proteins » Carbonic Anhydrase I/CA1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Carbonic Anhydrase I/CA1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Carbonic Anhydrase I/CA1 Recombinant Protein Antigen (NBP1-88191PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Carbonic Anhydrase I/CA1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CA1.

Source: E. coli

Amino Acid Sequence: NGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88191.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Carbonic Anhydrase I/CA1 Recombinant Protein Antigen

  • CA1
  • CA-I
  • Car1
  • Carbonate dehydratase I
  • carbonic anhydrase 1
  • Carbonic anhydrase B
  • Carbonic Anhydrase I
  • carbonic anhydrase ICAB
  • carbonic dehydratase
  • EC 4.2.1.1

Background

Carbonic anhydrase performs an important role in respiration by facilitating transfer of CO2. Carbonic Anhydrase I (CAI) is a single polypeptide chain metalloenzyme of molecular weight 29 kDa. It is present mainly in erythrocytes at a concentration of about 12 mg per gram haemoglobin. Its main enzyme function is to catalyse the reversible hydration of carbon dioxide. It also catalyses the hydrolysis of certain esters. The twelve active CA isozymes are thought to regulate a variety of cellular functions including several processes in the reproductive systems. A mutational deficiency has been described but patients exhibit no adverse chemical symptoms. Red cell CAI levels are decreased in patients with thyrotoxicosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Carbonic Anhydrase
III/CA3 Antibody (4A1 ...
H00000761-M02
Western Blot Carbonic Anhydrase III/CA3 Antibody (4A12-1A3)
Immunohistochemistry-Paraffin Carbonic Anhydrase III/CA3 Antibody (4A12-1A3)
Sandwich ELISA Carbonic Anhydrase III/CA3 Antibody (4A12-1A3)
(5 Publications)
Species: Hu, Mu
Applications: ELISA, Func, IHC, IHC-P, S-ELISA, WB
Carbonic Anhydrase
II/CA2 Antibody
NB600-919
Western Blot Carbonic Anhydrase II/CA2 Antibody
Western Blot Carbonic Anhydrase II/CA2 Antibody
Immunohistochemistry-Paraffin Carbonic Anhydrase II/CA2 Antibody
(3 Reviews)
(11 Publications)
Species: Hu, Mu
Applications: ELISA, IHC, IHC-Fr, IHC-P, WB
BDNF [HRP]
DBD00
N/A BDNF [HRP]
N/A BDNF [HRP]
N/A BDNF [HRP]
(104 Publications)
Species: Hu
Applications: ELISA
Carbonic Anhydrase
IV/CA4 Antibody (3104 ...
MAB2186
Western Blot Carbonic Anhydrase IV/CA4 Antibody (310413) [Unconjugated]
(5 Publications)
Species: Hu
Applications: IHC, IP, WB
GFAP Antibody
NB300-141
Immunohistochemistry GFAP Antibody
Western Blot GFAP Antibody
Western Blot GFAP Antibody
(12 Reviews)
(108 Publications)
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
(1 Review)
(20 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
beta Amyloid
Antibody (MOAB-2) - B ...
NBP2-13075
Immunohistochemistry-Frozen beta Amyloid Antibody (MOAB-2) - BSA Free
Immunohistochemistry beta Amyloid Antibody (MOAB-2) - BSA Free
Immunocytochemistry/ Immunofluorescence beta Amyloid Antibody (MOAB-2) - BSA Free
(2 Reviews)
(70 Publications)
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
GR/NR3C1 Antibody
(BuGR2) - BSA Free
NB300-731
Flow Cytometry GR/NR3C1 Antibody (BuGR2) - BSA Free
Flow Cytometry GR/NR3C1 Antibody (BuGR2) - BSA Free
Immunocytochemistry/ Immunofluorescence GR/NR3C1 Antibody (BuGR2) - BSA Free
(3 Reviews)
(12 Publications)
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
(7 Reviews)
(389 Publications)
Species: Hu, Mu
Applications: ICC, IHC
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
PRRT2 Antibody -
BSA Free
NBP2-82026
Western Blot PRRT2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PRRT2 Antibody - BSA Free
Immunohistochemistry PRRT2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Acetylcholinesterase/A
NB100-1519
Flow Cytometry Acetylcholinesterase/ACHE Antibody
Western Blot Acetylcholinesterase/ACHE Antibody
Immunocytochemistry/ Immunofluorescence Acetylcholinesterase/ACHE Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
Neuropeptide Y
Antibody
NBP1-46535
Immunohistochemistry Neuropeptide Y Antibody
Immunocytochemistry/ Immunofluorescence Neuropeptide Y Antibody
(20 Publications)
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
nNOS Antibody
NB100-858
Immunocytochemistry/ Immunofluorescence nNOS Antibody
Flow Cytometry nNOS Antibody
Immunocytochemistry/ Immunofluorescence nNOS Antibody
(1 Review)
(15 Publications)
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
Glutamine
Synthetase Antibody
NB110-41404
Immunocytochemistry/ Immunofluorescence Glutamine Synthetase Antibody
Western Blot Glutamine Synthetase Antibody
Immunohistochemistry Glutamine Synthetase Antibody
(1 Review)
(11 Publications)
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

Publications for Carbonic Anhydrase I/CA1 Recombinant Protein Antigen (NBP1-88191PEP) (0)

There are no publications for Carbonic Anhydrase I/CA1 Recombinant Protein Antigen (NBP1-88191PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carbonic Anhydrase I/CA1 Recombinant Protein Antigen (NBP1-88191PEP) (0)

There are no reviews for Carbonic Anhydrase I/CA1 Recombinant Protein Antigen (NBP1-88191PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Carbonic Anhydrase I/CA1 Recombinant Protein Antigen (NBP1-88191PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Carbonic Anhydrase I/CA1 Products

Research Areas for Carbonic Anhydrase I/CA1 Recombinant Protein Antigen (NBP1-88191PEP)

Find related products by research area.

Blogs on Carbonic Anhydrase I/CA1

There are no specific blogs for Carbonic Anhydrase I/CA1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Caspase‑3 was detected in immersion fixed anti-FAS treated Jurkat human acute T cell leukemia cell line using 0.3 µg/mL Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) for 3 hours at room temperature. Cells were stained (red) and counterstained (green). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Caspase-3 Antibody [Unconjugated] - Active
AF835
Immunohistochemistry: GFAP Antibody [NB300-141] - Analysis of a rat cerebellum section stained with rabbit polyclonal antibody to GFAP, NB300-141, dilution 1:5000 in green and mouse monoclonal antibody to MeCP2, dilution 1:500, in red. The blue is DAPI staining of nuclear DNA. Following transcardial perfusion of rat with 4% paraformaldehyde, brain was post fixed for 1 hour, cut to 45 uM, and free-floating sections were stained with above antibodies. The GFAP antibody stains the network of astrocytic cells and the processes of Bergmann glia in the molecular layer. The MeCP2 antibody specifically labels nuclei of certain neurons.
GFAP Antibody
NB300-141

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Carbonic Anhydrase I/CA1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CA1