![Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP2-38622] - Analysis in human parathyroid gland and skeletal muscle tissues using NBP2-38622 antibody. Corresponding CASR RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Calcium-sensing-R-CaSR-Antibody-Immunohistochemistry-Paraffin-NBP2-38622-img0013.jpg "Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP2-38622] - Analysis in human parathyroid gland and skeletal muscle tissues using NBP2-38622 antibody. Corresponding CASR RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWASSSLI |
| Predicted Species | Rat (98%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CASR |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Immunohistochemistry_16650.jpg)
![Western Blot PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Western_Blot_16656.jpg)
| Publication using NBP2-38622 | Applications | Species |
|---|---|---|
| Nunez-Salces M, Li H, Christie S, Page AJ The Effect of High-Fat Diet-Induced Obesity on the Expression of Nutrient Chemosensors in the Mouse Stomach and the Gastric Ghrelin Cell Nutrients 2020-08-19 [PMID: 32824949] (IHC-Fr, Mouse) | IHC-Fr | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for Calcium-sensing R/CaSR Antibody (NBP2-38622)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP2-38622] - Staining of human kidney, liver, pancreas and parathyroid gland using Anti-CASR antibody NBP2-38622 (A) shows similar protein distribution across tissues to independent antibody NBP1-84687 (B).](http://images.novusbio.com/fullsize/Calcium-sensing-R-CaSR-Antibody-Immunohistochemistry-Paraffin-NBP2-38622-img0012.jpg "Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP2-38622] - Staining of human kidney, liver, pancreas and parathyroid gland using Anti-CASR antibody NBP2-38622 (A) shows similar protein distribution across tissues to independent antibody NBP1-84687 (B).")
![Western Blot: Calcium-sensing R/CaSR Antibody [NBP2-38622] - Analysis in control (vector only transfected HEK293T lysate) and CASR over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/Calcium-sensing-R-CaSR-Antibody-Western-Blot-NBP2-38622-img0006.jpg "Western Blot: Calcium-sensing R/CaSR Antibody [NBP2-38622] - Analysis in control (vector only transfected HEK293T lysate) and CASR over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP2-38622] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/Calcium-sensing-R-CaSR-Antibody-Immunohistochemistry-Paraffin-NBP2-38622-img0017.jpg "Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP2-38622] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP2-38622] - Staining of human parathyroid gland shows strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/Calcium-sensing-R-CaSR-Antibody-Immunohistochemistry-Paraffin-NBP2-38622-img0014.jpg "Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP2-38622] - Staining of human parathyroid gland shows strong membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP2-38622] - Staining of human kidney shows moderate membranous positivity in cells in distal tubules.](http://images.novusbio.com/fullsize/Calcium-sensing-R-CaSR-Antibody-Immunohistochemistry-Paraffin-NBP2-38622-img0015.jpg "Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP2-38622] - Staining of human kidney shows moderate membranous positivity in cells in distal tubules.")
![Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP2-38622] - Staining of human pancreas shows weak to moderate membranous positivity in islets of Langerhans.](http://images.novusbio.com/fullsize/Calcium-sensing-R-CaSR-Antibody-Immunohistochemistry-Paraffin-NBP2-38622-img0016.jpg "Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP2-38622] - Staining of human pancreas shows weak to moderate membranous positivity in islets of Langerhans.")
![Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP2-38622] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/Calcium-sensing-R-CaSR-Antibody-Immunohistochemistry-Paraffin-NBP2-38622-img0018.jpg "Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP2-38622] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![PXR/NR1I2 Antibody (H4417) [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "PXR/NR1I2 Antibody (H4417) [Unconjugated]")
![Western Blot CXADR Antibody [Unconjugated]](https://images.novusbio.com/images2/CXADR_AF2654_Western_Blot_17043.jpg)
![Simple Western CXADR Antibody [Unconjugated]](https://images.novusbio.com/images2/CXADR_AF2654_Immunohistochemistry_17641.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")