Home » CACNB1 » CACNB1 Proteins » CACNB1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

CACNB1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CACNB1 Protein (NBP1-86681PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CACNB1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CACNB1.

Source: E. coli

Amino Acid Sequence: GSRNSAYTELGDSCVDMETDPSEGPGLGDPAGGGTPPARQGSWEDEEEDYEEELTDNRNRGRNKARYCAEGGGPVLGRNKNELEGWGRGVYIR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CACNB1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86681.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CACNB1 Recombinant Protein Antigen

  • CAB1
  • CACNB1
  • CACNLB1
  • CACNLB1calcium channel, L type, beta 1 polypeptide
  • Calcium channel voltage-dependent subunit beta 1
  • calcium channel, voltage-dependent, beta 1 subunit
  • CCHLB1
  • dihydropyridine-sensitive L-type, calcium channel beta-1 subunit
  • MGC41896
  • voltage-dependent L-type calcium channel subunit beta-1

Background

CACNB1 is encoded by this gene belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

LIGHT/TNFSF14
[Unconjugated]
664-LI
SDS-PAGE LIGHT/TNFSF14 [Unconjugated]
Bioactivity LIGHT/TNFSF14 [Unconjugated]
(21 Publications)
Species: Hu
Applications: BA
integrin beta 4
binding protein Antib ...
NBP2-13954
Immunocytochemistry/ Immunofluorescence integrin beta 4 binding protein Antibody
Immunohistochemistry-Paraffin integrin beta 4 binding protein Antibody
Immunohistochemistry-Paraffin integrin beta 4 binding protein Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Carbonic Anhydrase
I/CA1 Antibody
NBP1-88191
Western Blot Carbonic Anhydrase I/CA1 Antibody
Immunohistochemistry-Paraffin Carbonic Anhydrase I/CA1 Antibody
Immunohistochemistry-Paraffin Carbonic Anhydrase I/CA1 Antibody
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NPDC-1 Antibody
AF5489
Western Blot NPDC-1 Antibody
Immunohistochemistry NPDC-1 Antibody
Species: Hu
Applications: IHC, WB
PGAP3 Antibody
NBP3-12196
Immunohistochemistry-Paraffin PGAP3 Antibody
Species: Hu, Mu, Rt
Applications: DB, ELISA, IHC, IHC-P, IP, WB
CACNB2 Antibody
(6C4)
H00000783-M05
Western Blot CACNB2 Antibody (6C4)
Western Blot CACNB2 Antibody (6C4)
ELISA CACNB2 Antibody (6C4)
(2 Reviews)
(3 Publications)
Species: Hu, Mu
Applications: ELISA, WB
CACNA1S Antibody
(1A) - BSA Free
NB300-542
Flow Cytometry CACNA1S Antibody (1A) - BSA Free
Immunohistochemistry-Paraffin CACNA1S Antibody (1A) - BSA Free
(2 Publications)
Species: Gp, Hu, Mu, Rb, Rt
Applications: Flow, IHC, IHC-Fr, IHC-P, IP, WB
GRB7 Antibody
[Unconjugated]
AF4856
Western Blot GRB7 Antibody [Unconjugated]
Immunohistochemistry GRB7 Antibody [Unconjugated]
Species: Hu, Mu, Rt
Applications: IHC, WB
QDPR Antibody
AF8038
Western Blot QDPR Antibody
Species: Hu, Mu, Rt
Applications: WB
G protein alpha
inhibitor 1 Antibody ...
H00002770-M01
Western Blot G protein alpha inhibitor 1 Antibody (2B8-2A5)
Immunohistochemistry-Paraffin G protein alpha inhibitor 1 Antibody (2B8-2A5)
Sandwich ELISA G protein alpha inhibitor 1 Antibody (2B8-2A5)
(1 Publication)
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
TRNT1 Antibody
NBP1-86589
Immunohistochemistry-Paraffin TRNT1 Antibody
Immunocytochemistry/ Immunofluorescence TRNT1 Antibody
Western Blot TRNT1 Antibody
(7 Publications)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
CACNB4 Antibody
NBP1-83984
Western Blot CACNB4 Antibody
Immunohistochemistry-Paraffin CACNB4 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Cav1.2 Antibody
(S57)
NBP1-22439
Immunocytochemistry/ Immunofluorescence Cav1.2 Antibody (S57)
Western Blot Cav1.2 Antibody (S57)
Immunohistochemistry Cav1.2 Antibody (S57)
(3 Publications)
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
CACNA2D1 Antibody
(20A)
NB120-2864
Western Blot CACNA2D1 Antibody (20A)
Immunohistochemistry-Paraffin CACNA2D1 Antibody (20A)
Immunohistochemistry-Paraffin CACNA2D1 Antibody (20A)
(1 Review)
(10 Publications)
Species: Gp, Hu, Mu, Po, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Ryanodine Receptor
Antibody (34C) - BSA ...
NB300-543
Immunohistochemistry-Paraffin Ryanodine Receptor Antibody (34C) - BSA Free
(12 Publications)
Species: Am, Bv, Ca, Ma, Fi, Hu, Ma-Mn, Mu, Pm, Rb, Rt, Sh
Applications: B/N, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
STARD3 Antibody
NBP3-17314
Western Blot STARD3 Antibody
Immunocytochemistry/ Immunofluorescence STARD3 Antibody
Species: Hu
Applications: ICC/IF, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Cav3.2 Antibody
(S55/10)
NBP1-22444
Western Blot Cav3.2 Antibody (S55/10)
Immunohistochemistry-Paraffin Cav3.2 Antibody (S55/10)
Western Blot Cav3.2 Antibody (S55/10)
(1 Review)
(10 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, MiAr, WB

Publications for CACNB1 Protein (NBP1-86681PEP) (0)

There are no publications for CACNB1 Protein (NBP1-86681PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CACNB1 Protein (NBP1-86681PEP) (0)

There are no reviews for CACNB1 Protein (NBP1-86681PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CACNB1 Protein (NBP1-86681PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CACNB1 Products

Blogs on CACNB1

There are no specific blogs for CACNB1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
p53 Antibody (PAb 240) - BSA Free
NB200-103
Western Blot: CACNA2D1 Antibody (20A) [NB120-2864] - Primary antibody dilution- 1:1000 for 2 Hours at RT, in blocking buffer, 5% Milk in TBS-0.05% Tween : Blocking Overnight at +4 degree C. Secondary antibody : 1:2000 in blocking buffer, 1 hour at RT. Image from verified customer review.
CACNA2D1 Antibody (20A)
NB120-2864

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CACNB1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CACNB1