CA125/MUC16 Antibody (CL2783) Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GVLVTTRRRKKEGEYNVQQQCPGYYQSHLDLEDLQ |
Epitope |
NVQQQCPGYYQSHLD |
Isotype |
IgG2b |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
MUC16 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Protein A purified |
Alternate Names for CA125/MUC16 Antibody (CL2783)
Background
MUC16 (CA125) is a serum marker that is used routinely in gynecologic practice to monitor patients with ovarian cancer. It is a mullerian duct differentiation antigen that is over expressed in epithelial ovarian cancer cells and secreted into the blood, although its expression is not entirely confined to ovarian cancer. Most biochemical studies have concluded that MUC16 is a high molecular mass glycoprotein, although estimates of its size range from 200 to 2000 kDa with smaller "subunits" being described by some investigators.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-P, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KD, Simple Western, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, KO
Species: Hu
Applications: IP (-), WB
Publications for CA125/MUC16 Antibody (NBP2-59024) (0)
There are no publications for CA125/MUC16 Antibody (NBP2-59024).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CA125/MUC16 Antibody (NBP2-59024) (0)
There are no reviews for CA125/MUC16 Antibody (NBP2-59024).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for CA125/MUC16 Antibody (NBP2-59024) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CA125/MUC16 Products
Research Areas for CA125/MUC16 Antibody (NBP2-59024)
Find related products by research area.
|
Blogs on CA125/MUC16