Home » BMI-1 » BMI-1 Proteins » BMI-1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

BMI-1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for BMI-1 Recombinant Protein Antigen (NBP1-87321PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

BMI-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BMI1.

Source: E. coli

Amino Acid Sequence: RPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BMI1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87321.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BMI-1 Recombinant Protein Antigen

  • B lymphoma Mo-MLV insertion region 1 homolog (mouse)
  • B lymphoma Mo-MLV insertion region 1 homolog
  • BMI1 polycomb ring finger oncogene
  • BMI1
  • BMI-1
  • FLVI2/BMI1
  • MGC12685
  • murine leukemia viral (bmi-1) oncogene homolog
  • PCGF4
  • polycomb complex protein BMI-1
  • polycomb group protein Bmi1
  • polycomb group ring finger 4
  • RING finger protein 51
  • RNF51
  • RNF51Polycomb group RING finger protein 4

Background

Bmi1 polycomb ring finger oncogene regulates the cell cycle inhibitor genes p16 and p19, with implications in hematopoiesis, skeletal patterning, neurological functions, and development of the cerebellum. Bmi 1 has been shown to induce telomerase activity and immortalize human mammary epithelial cells, and extend the replicative life span of human fibroblasts by suppressing the p16-dependent senescence pathway. Bmi-1 is also required for efficient self-renewing cell division in adult hematopoietic and neural stem cells.

Aberrant expression of Bmi-1 has been found in several types of cancer in the bladder, skin, blood, prostate, breast, ovaries, andcolon. Its overexpression is especially pronounced in mantle cell lymphomas. Thereforem Bmi1 antibodies will be useful tools for many cancer development studies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
BMI-1 Antibody
(LLBmi1-1) - BSA Free
NBP1-96140
Flow Cytometry BMI-1 Antibody (LLBmi1-1) - BSA Free
Flow Cytometry BMI-1 Antibody (LLBmi1-1) - BSA Free
Immunocytochemistry/ Immunofluorescence BMI-1 Antibody (LLBmi1-1) - BSA Free
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: ChIP, Flow-IC, Flow, ICC/IF, IP, WB
EZH2/KMT6 Antibody
[Unconjugated]
AF4767
Western Blot EZH2/KMT6 Antibody [Unconjugated]
Western Blot EZH2/KMT6 Antibody [Unconjugated]
Western Blot EZH2/KMT6 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu
Applications: ICC, WB
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Western Blot c-Myc Antibody (9E10) - BSA Free
(4 Reviews)
(46 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
PRC1 Antibody
NBP1-88856
Immunohistochemistry-Paraffin PRC1 Antibody
Immunohistochemistry-Paraffin PRC1 Antibody
Immunohistochemistry-Paraffin PRC1 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MEL-18 Antibody
NB100-1240
Western Blot MEL-18 Antibody
Western Blot MEL-18 Antibody
(1 Publication)
Species: Hu
Applications: PEP-ELISA, WB
RNF2 Antibody (6C2)
H00006045-M01
Western Blot RNF2 Antibody (6C2)
Western Blot RNF2 Antibody (6C2)
Sandwich ELISA RNF2 Antibody (6C2)
(4 Publications)
Species: Hu, I, Mu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
RING1 Antibody
NBP1-80830
Immunocytochemistry/ Immunofluorescence RING1 Antibody
Western Blot RING1 Antibody
Immunohistochemistry-Paraffin RING1 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Oct-3/4 Antibody
[Unconjugated]
AF1759
Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]
Immunocytochemistry Oct-3/4 Antibody [Unconjugated]
Simple Western Oct-3/4 Antibody [Unconjugated]
(75 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
TERT Antibody (2C4)
NB100-317
Immunohistochemistry-Paraffin TERT Antibody (2C4)
Immunohistochemistry-Paraffin TERT Antibody (2C4)
Flow Cytometry TERT Antibody (2C4)
(26 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, WB
CD133 Antibody -
BSA Free
NB120-16518
Immunohistochemistry-Paraffin CD133 Antibody - BSA Free
Western Blot CD133 Antibody - BSA Free
Chromatin Immunoprecipitation CD133 Antibody - BSA Free
(42 Publications)
Species: Hu, Mu, Po, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
BMI-1 Recombinant
Protein Antigen
NBP1-87321PEP
BMI-1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for BMI-1 Recombinant Protein Antigen (NBP1-87321PEP) (0)

There are no publications for BMI-1 Recombinant Protein Antigen (NBP1-87321PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BMI-1 Recombinant Protein Antigen (NBP1-87321PEP) (0)

There are no reviews for BMI-1 Recombinant Protein Antigen (NBP1-87321PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BMI-1 Recombinant Protein Antigen (NBP1-87321PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BMI-1 Products

Research Areas for BMI-1 Recombinant Protein Antigen (NBP1-87321PEP)

Find related products by research area.

Blogs on BMI-1

There are no specific blogs for BMI-1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: BMI-1 Antibody (LLBmi1-1) [NBP1-96140] - An intracellular stain was performed on U2OS cells with BMI-1 Antibody [LLBmi1-1] NBP1-96140AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
BMI-1 Antibody (LLBmi1-1) - BSA Free
NBP1-96140
Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on U-937 cells with c-Myc Antibody (9E10) NB600-302AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
c-Myc Antibody (9E10) - BSA Free
NB600-302

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BMI-1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol BMI1