![Immunohistochemistry-Paraffin: BDH2 Antibody [NBP1-85218] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/BDH2-Antibody-Immunohistochemistry-Paraffin-NBP1-85218-img0007.jpg "Immunohistochemistry-Paraffin: BDH2 Antibody [NBP1-85218] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CPGTVDTPSLQERIQARGNPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIIDGGWSL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | BDH2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry Prohibitin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prohibitin_AF3470_Immunocytochemistry__Immunofluorescence_20123.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for BDH2 Antibody (NBP1-85218)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | BDH2 |
![Immunohistochemistry-Paraffin: BDH2 Antibody [NBP1-85218] - Staining of human duodenum shows strong cytoplasmic and nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/BDH2-Antibody-Immunohistochemistry-Paraffin-NBP1-85218-img0002.jpg "Immunohistochemistry-Paraffin: BDH2 Antibody [NBP1-85218] - Staining of human duodenum shows strong cytoplasmic and nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: BDH2 Antibody [NBP1-85218] - Staining of human kidney shows high expression.](http://images.novusbio.com/fullsize/BDH2-Antibody-Immunohistochemistry-Paraffin-NBP1-85218-img0003.jpg "Immunohistochemistry-Paraffin: BDH2 Antibody [NBP1-85218] - Staining of human kidney shows high expression.")
![Immunohistochemistry-Paraffin: BDH2 Antibody [NBP1-85218] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/BDH2-Antibody-Immunohistochemistry-Paraffin-NBP1-85218-img0004.jpg "Immunohistochemistry-Paraffin: BDH2 Antibody [NBP1-85218] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: BDH2 Antibody [NBP1-85218] - Staining in human kidney and skeletal muscle tissues using anti-BDH2 antibody. Corresponding BDH2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/BDH2-Antibody-Immunohistochemistry-Paraffin-NBP1-85218-img0005.jpg "Immunohistochemistry-Paraffin: BDH2 Antibody [NBP1-85218] - Staining in human kidney and skeletal muscle tissues using anti-BDH2 antibody. Corresponding BDH2 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: BDH2 Antibody [NBP1-85218] - Staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/BDH2-Antibody-Immunohistochemistry-Paraffin-NBP1-85218-img0006.jpg "Immunohistochemistry-Paraffin: BDH2 Antibody [NBP1-85218] - Staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.")
![N/A Lipocalin-2/NGAL [Biotin]](https://images.novusbio.com/images2/DATA_Lipocalin2_DY1857_ELISA_2306.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")