Home » ATP8A1 » ATP8A1 Antibodies » ATP8A1 Antibody
Novus Biologicals products are now on bio-techne.com

ATP8A1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: ATP8A1 Antibody [NBP2-30403] - Analysis in human cerebral cortex and liver tissues. Corresponding ATP8A1 RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: ATP8A1 Antibody [NBP2-30403] - Analysis in human cerebral cortex and liver tissues. Corresponding ATP8A1 RNA-seq data are presented for the same tissues.
Western Blot: ATP8A1 Antibody [NBP2-30403] - Analysis in human cell line Daudi.
Immunocytochemistry/ Immunofluorescence: ATP8A1 Antibody [NBP2-30403] - Staining of human cell line PC-3 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ATP8A1 Antibody [NBP2-30403] - Staining of human small intestine shows moderate membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: ATP8A1 Antibody [NBP2-30403] - Staining of human cerebral cortex shows strong membranous and cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: ATP8A1 Antibody [NBP2-30403] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: ATP8A1 Antibody [NBP2-30403] - Staining of human lymph node shows moderate membranous positivity in germinal center cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ATP8A1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KSQDPGAVVLGKSLTERAQLLKNVFKKNHVNLYRSESLQQNLLHGYAFSQDENGIVSQSEVI
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP8A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ATP8A1 Protein (NBP2-30403PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP8A1 Antibody

  • probable phospholipid-transporting ATPase IA
  • ATPase, aminophospholipid transporter (APLT), class I, type 8A, member 1
  • ATPASEII
  • ATPIA
  • ATPP2

Background

The P-type adenosinetriphosphatases (P-type ATPases) are a family of proteins which use the free energy of ATP hydrolysis to drive uphill transport of ions across membranes. Several subfamilies of P-type ATPases have been identified. One subfamily catalyzes transport of heavy metal ions. Another subfamily transports non-heavy metal ions (NMHI). The protein encoded by this gene is a member of the third subfamily of P-type ATPases and acts to transport amphipaths, such as phosphatidylserine. Two transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Prolyl
Oligopeptidase/PREP A
NBP2-33950
Immunocytochemistry/ Immunofluorescence Prolyl Oligopeptidase/PREP Antibody
Immunohistochemistry-Paraffin Prolyl Oligopeptidase/PREP Antibody
Immunohistochemistry-Paraffin Prolyl Oligopeptidase/PREP Antibody
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AP3B1 Antibody
NBP3-38363
Western Blot AP3B1 Antibody
Immunohistochemistry AP3B1 Antibody
Immunohistochemistry AP3B1 Antibody
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Annexin V
Apoptosis Kit [FITC]
NBP2-29373
Flow Cytometry Annexin V Apoptosis Kit [FITC]
Flow Cytometry Annexin V Apoptosis Kit [FITC]
Flow Cytometry Annexin V Apoptosis Kit [FITC]
(2 Reviews)
(32 Publications)
Species: Hu, Mu, Rt
Applications: Flow-CS, Flow, ICC/IF
Coagulation Factor
X Antibody
NBP1-33320
Western Blot Coagulation Factor X Antibody
Immunocytochemistry/ Immunofluorescence Coagulation Factor X Antibody
Immunohistochemistry-Paraffin Coagulation Factor X Antibody
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
BRIC Antibody
NBP1-90068
Immunohistochemistry-Paraffin BRIC Antibody
Immunohistochemistry-Paraffin BRIC Antibody
Immunohistochemistry-Paraffin BRIC Antibody
Species: Hu
Applications: IHC, IHC-P
ATP10A Antibody
NBP2-30505
Immunohistochemistry ATP10A Antibody
Species: Hu
Applications: IHC, IHC-P
Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
(7 Reviews)
(389 Publications)
Species: Hu, Mu
Applications: ICC, IHC
PLA2G1B Antibody
(630823)
MAB5018
Western Blot PLA2G1B Antibody (630823)
Species: Hu
Applications: IP, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
ARF1 Antibody
NBP2-29906
Immunocytochemistry/ Immunofluorescence ARF1 Antibody
Immunohistochemistry-Paraffin ARF1 Antibody
Immunohistochemistry-Paraffin ARF1 Antibody
(2 Publications)
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
TRAPPC9 Antibody
NB100-55735
TRAPPC9 Antibody
(1 Publication)
Species: Bv, Ca, Ch, Hu, Mu, Pm
Applications: ICC/IF, IP, WB
ACAA2 Antibody
(OTI1C10)
NBP2-46477
Immunofluorescence ACAA2 Antibody (OTI1C10)
Immunofluorescence ACAA2 Antibody (OTI1C10)
Immunohistochemistry ACAA2 Antibody (OTI1C10)
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MRP1 Antibody
(IU2H10) - BSA Free
NB400-156
Dual RNAscope ISH-IHC MRP1 Antibody (IU2H10) - BSA Free
Western Blot MRP1 Antibody (IU2H10) - BSA Free
Immunocytochemistry/ Immunofluorescence MRP1 Antibody (IU2H10) - BSA Free
(17 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB
Phospholipase B1
Antibody (C4)
NBP3-41952
Immunohistochemistry-Paraffin Phospholipase B1 Antibody (C4)
Species: Hu, Po
Applications: ICC/IF, IHC, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB

Publications for ATP8A1 Antibody (NBP2-30403) (0)

There are no publications for ATP8A1 Antibody (NBP2-30403).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP8A1 Antibody (NBP2-30403) (0)

There are no reviews for ATP8A1 Antibody (NBP2-30403). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ATP8A1 Antibody (NBP2-30403) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP8A1 Products

Research Areas for ATP8A1 Antibody (NBP2-30403)

Find related products by research area.

Blogs on ATP8A1

There are no specific blogs for ATP8A1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP8A1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ATP8A1
Uniprot