![Immunohistochemistry-Paraffin: ATP6V0D2 Antibody [NBP2-31600] - Analysis in human kidney and pancreas tissues. Corresponding ATP6V0D2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ATP6V0D2-Antibody-Immunohistochemistry-Paraffin-NBP2-31600-img0015.jpg "Immunohistochemistry-Paraffin: ATP6V0D2 Antibody [NBP2-31600] - Analysis in human kidney and pancreas tissues. Corresponding ATP6V0D2 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EDRETLYPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ATP6V0D2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot RFC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RFC1_AF6457_Western_Blot_9874.jpg)
| Publication using NBP2-31600 | Applications | Species |
|---|---|---|
| Sarkanya B, Kuthib L, Kovacs G Novel concept of Wilms' tumor development: involvement of pluripotential cells of ureteric bud Human pathology 2023-05-18 [PMID: 37209922] (IHC-P, Human) Details: 1:200 IHC-P dilution |
IHC-P | Human |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Santhosh Sivajothi |
IHC-P | Human | 05/22/2018 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: ATP6V0D2 Antibody [NBP2-31600] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Kidney tissue](http://images.novusbio.com/fullsize/ATP6V0D2-Antibody-Western-Blot-NBP2-31600-img0007.jpg "Western Blot: ATP6V0D2 Antibody [NBP2-31600] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Kidney tissue")
![Immunohistochemistry-Paraffin: ATP6V0D2 Antibody [NBP2-31600] - Staining of human tonsil shows no positivity in germinal center and non-germinal center cells as expected.](http://images.novusbio.com/fullsize/ATP6V0D2-Antibody-Immunohistochemistry-Paraffin-NBP2-31600-img0018.jpg "Immunohistochemistry-Paraffin: ATP6V0D2 Antibody [NBP2-31600] - Staining of human tonsil shows no positivity in germinal center and non-germinal center cells as expected.")
![Immunohistochemistry-Paraffin: ATP6V0D2 Antibody [NBP2-31600] - Staining of human kidney shows high expression.](http://images.novusbio.com/fullsize/ATP6V0D2-Antibody-Immunohistochemistry-Paraffin-NBP2-31600-img0011.jpg "Immunohistochemistry-Paraffin: ATP6V0D2 Antibody [NBP2-31600] - Staining of human kidney shows high expression.")
![Immunohistochemistry-Paraffin: ATP6V0D2 Antibody [NBP2-31600] - Human kidney tissue. Heat mediated antigen retrieval was performed by heating in citrate buffer (pH 6) at 95C for 20 minutes. Image from verified customer review.](http://images.novusbio.com/fullsize/ATP6V0D2-Antibody-Immunohistochemistry-Paraffin-NBP2-31600-img0014.jpg "Immunohistochemistry-Paraffin: ATP6V0D2 Antibody [NBP2-31600] - Human kidney tissue. Heat mediated antigen retrieval was performed by heating in citrate buffer (pH 6) at 95C for 20 minutes. Image from verified customer review.")
![Immunohistochemistry-Paraffin: ATP6V0D2 Antibody [NBP2-31600] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/ATP6V0D2-Antibody-Immunohistochemistry-Paraffin-NBP2-31600-img0016.jpg "Immunohistochemistry-Paraffin: ATP6V0D2 Antibody [NBP2-31600] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Immunohistochemistry-Paraffin: ATP6V0D2 Antibody [NBP2-31600] - Staining of human small intestine shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/ATP6V0D2-Antibody-Immunohistochemistry-Paraffin-NBP2-31600-img0017.jpg "Immunohistochemistry-Paraffin: ATP6V0D2 Antibody [NBP2-31600] - Staining of human small intestine shows no positivity in glandular cells as expected.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
