![Western Blot: ATG10 Antibody [NBP2-38524] - ATG10 is involved in p62-regulated autophagy. RPE cells were transfected with p62 or scrambled siRNA for 24h and then exposed with 400 H2O2 for 1, 3, 6, 12h respectively. Whole-cells lysates were analyzed by Western blot with anti-p62, ATG10, or beta-actin antibodies. Differences between means were considered statistically significant when p<0.05 by Mann-Whitney U-test. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0171940), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/ATG10-Antibody-Western-Blot-NBP2-38524-img0006.jpg "Western Blot: ATG10 Antibody [NBP2-38524] - ATG10 is involved in p62-regulated autophagy. RPE cells were transfected with p62 or scrambled siRNA for 24h and then exposed with 400 H2O2 for 1, 3, 6, 12h respectively. Whole-cells lysates were analyzed by Western blot with anti-p62, ATG10, or beta-actin antibodies. Differences between means were considered statistically significant when p<0.05 by Mann-Whitney U-test. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0171940), licensed under a CC-BY license.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLGASTHGQTCLPMEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDGRPLTLKDIWEGVHECYKM |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ATG10 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. Western Blot reactivity reported in (PMID: 28222108). |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry ATG7 Antibody (683906) [Unconjugated]](https://images.novusbio.com/images2/ATG7_MAB6608_Immunohistochemistry_10631.jpg)
![Simple Western ATG7 Antibody (683906) [Unconjugated]](https://images.novusbio.com/images2/ATG7_MAB6608_Simple_Western_16409.jpg)
![Western Blot ATG7 Antibody (683906) [Unconjugated]](https://images.novusbio.com/images2/ATG7_MAB6608_Western_Blot_11614.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for ATG10 Antibody (NBP2-38524)Find related products by research area.
|
|
Animal Models to Study Autophagy By Christina Towers, PhD What is autophagy?Autophagy is the catabolic process that degrades cytoplasmic material via the lysosome. The process of macroautophagy was originally characterized in yeast, where the... Read full blog post. |
|
From Then ‘till Now: The History of Autophagy and Cancer Research By Christina Towers, PhD. The fundamental process that cells use to degrade damaged cytoplasmic material and recycle nutrients is called autophagy. This term was first coined by the Belgium biochemist Christian de... Read full blog post. |
|
ATG12 - a ubiquitin-like protein essential for autophagosome assembly Atg12 is a ubiquitin-like protein that plays an essential role in cellular homeostasis by regulating the degradation and recycling of cytoplasmic organelles and macromolecules. Atg12 is one of two ubiquitin-like protein systems that is required du... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: ATG10 Antibody [NBP2-38524] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli. Antibody staining shown in green.](http://images.novusbio.com/fullsize/ATG10-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38524-img0004.jpg "Immunocytochemistry/Immunofluorescence: ATG10 Antibody [NBP2-38524] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli. Antibody staining shown in green.")
![Immunohistochemistry-Paraffin: ATG10 Antibody [NBP2-38524] - Staining of human stomach shows moderate membranous and cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/ATG10-Antibody-Immunohistochemistry-Paraffin-NBP2-38524-img0005.jpg "Immunohistochemistry-Paraffin: ATG10 Antibody [NBP2-38524] - Staining of human stomach shows moderate membranous and cytoplasmic positivity in glandular cells.")
![Knockdown Validated: ATG10 Antibody [NBP2-38524] - ARPE-19 cells were transfected with pooled ATG10 specific siRNAs or scrambled siRNA (30nM) for 24h. ATG10 and ATG5 levels were assessed in protein lysates by Western Blot. (B) RNA isolated from cells was analyzed for ATG10 mRNA expression by qRT- PCR. Differences between means were considered statistically significant when p<0.05 by Mann-Whitney U-test. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/28222108/), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/nbp2-38524_rabbit-polyclonal-atg10-antibody-20920231412576.jpg "Knockdown Validated: ATG10 Antibody [NBP2-38524] - ARPE-19 cells were transfected with pooled ATG10 specific siRNAs or scrambled siRNA (30nM) for 24h. ATG10 and ATG5 levels were assessed in protein lysates by Western Blot. (B) RNA isolated from cells was analyzed for ATG10 mRNA expression by qRT- PCR. Differences between means were considered statistically significant when p<0.05 by Mann-Whitney U-test. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/28222108/), licensed under a CC-BY license.")
![Western Blot: ATG10 Antibody [NBP2-38524] - Knockdown of ATG10 makes ARPE-19 cells more sensitive to H2O2.(A) ARPE-19 cells were transfected with pooled ATG10 specific siRNAs or scrambled siRNA (30nM) for 24h. ATG10 & ATG5 levels were assessed in protein lysates by Western Blot. (B) RNA isolated from cells was analyzed for ATG10 mRNA expression by qRT- PCR. Differences between means were considered statistically significant when p<0.05 by Mann-Whitney U-test. (C) Lysates of ARPE-19 cells transfected with siRNAs for 24 hours were assessed for p62 & LC3 levels by Western blot. One set of wells per experiment was exposed to Bafilomycin A1 (75nM) for 3h prior to harvest. beta -actin was used as an internal control. ‘Short’ & ‘Long’ Exposure indicate time of exposure of immunoblot image. (D) 24h after transfection with respective siRNAs, ARPE-19 were subjected to oxidative stress with 800μM H2O2 & incubated at 37°C for 6h. Total cell numbers were determined by trypsinization & counting on TC10® cell counter. (E) Primary fetal RPE cells were transfected with scrambled or pooled ATG10 specific siRNAs & 48 hours after transfection, were subjected to H2O2 for 24 hours & MTT assay was performed. Differences between means were considered statistically significant when p<0.05 by Student’s t-test. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/28222108), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp2-38524_rabbit-polyclonal-atg10-antibody-31020241613645.jpg "Western Blot: ATG10 Antibody [NBP2-38524] - Knockdown of ATG10 makes ARPE-19 cells more sensitive to H2O2.(A) ARPE-19 cells were transfected with pooled ATG10 specific siRNAs or scrambled siRNA (30nM) for 24h. ATG10 & ATG5 levels were assessed in protein lysates by Western Blot. (B) RNA isolated from cells was analyzed for ATG10 mRNA expression by qRT- PCR. Differences between means were considered statistically significant when p<0.05 by Mann-Whitney U-test. (C) Lysates of ARPE-19 cells transfected with siRNAs for 24 hours were assessed for p62 & LC3 levels by Western blot. One set of wells per experiment was exposed to Bafilomycin A1 (75nM) for 3h prior to harvest. beta -actin was used as an internal control. ‘Short’ & ‘Long’ Exposure indicate time of exposure of immunoblot image. (D) 24h after transfection with respective siRNAs, ARPE-19 were subjected to oxidative stress with 800μM H2O2 & incubated at 37°C for 6h. Total cell numbers were determined by trypsinization & counting on TC10® cell counter. (E) Primary fetal RPE cells were transfected with scrambled or pooled ATG10 specific siRNAs & 48 hours after transfection, were subjected to H2O2 for 24 hours & MTT assay was performed. Differences between means were considered statistically significant when p<0.05 by Student’s t-test. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/28222108), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Western_Blot_19121.jpg)
![Immunohistochemistry Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Immunohistochemistry_19158.jpg)
![Immunohistochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunohistochemistry_16919.jpg)
![Immunocytochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunocytochemistry__Immunofluorescence_16973.jpg)
![Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images/af1916_human-p63-tp73l-affinity-purified-polyclonal-ab-41202412401237.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")