Novus Biologicals products are now on bio-techne.com

ATE1 Antibody (2B6)

Name: ATE1 Antibody (2B6)
Brand: Novus Biologicals
SKU: H00011101-M01
Price: 499 USD

Submit a Review

Images

(

Enlarge)

Western Blot: ATE1 Antibody (2B6) [H00011101-M01] - ATE1 monoclonal antibody (M01), clone 2B6. Analysis of ATE1 expression in Jurkat.

Immunocytochemistry/ Immunofluorescence: ATE1 Antibody (2B6) [H00011101-M01] - Analysis of monoclonal antibody to ATE1 on HeLa cell . Antibody concentration 10 ug/ml.

Western Blot: ATE1 Antibody (2B6) [H00011101-M01] - Analysis of ATE1 expression in transfected 293T cell line by ATE1 monoclonal antibody (M01), clone 2B6.Lane 1: ATE1 transfected lysate (Predicted MW: 59 KDa).Lane 2: ...read more

Sandwich ELISA: ATE1 Antibody (2B6) [H00011101-M01] - Detection limit for recombinant GST tagged ATE1 is 3 ng/ml as a capture antibody.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	WB, ELISA, ICC/IF
Clone	2B6
Clonality	Monoclonal
Host	Mouse
Conjugate	Unconjugated

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ATE1 Antibody (2B6) Summary

Immunogen	ATE1 (NP_001001976, 1 a.a. ~ 87 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAFWAGGSPSVVDYFPSEDFYRCGYCKNESGSRSNGMWAHSMTVQDYQDLIDRGWRRSGKYVYKPVMNQTCCPQYTIRCRPLQFQPS
Specificity	arginyltransferase 1
Isotype	IgG2b Kappa
Clonality	Monoclonal
Host	Mouse
Gene	ATE1
Purity	Protein A purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Applications/Dilutions

Dilutions	ELISA Immunocytochemistry/ Immunofluorescence Sandwich ELISA Western Blot
Application Notes	This antibody is reactive against recombinant protein in western blot and ELISA.

Packaging, Storage & Formulations

Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer	In 1x PBS, pH 7.4
Preservative	No Preservative
Purity	Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATE1 Antibody (2B6)

Arginine-tRNA--protein transferase 1
arginyltransferase 1MGC26724
arginyl-tRNA--protein transferase 1
arginyl-tRNA-protein transferase
EC 2.3.2.8
R-transferase 1

Background

This gene encodes an arginyltransferase, an enzyme that is involved in posttranslational conjugation of arginine to N-terminal aspartate or glutamate residues. Conjugation of arginine to the N-terminal aspartate or glutamate targets proteins for ubiquitin-dependent degradation. Alternative splicing results in two transcript variants encoding distinct isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Spectrin beta 2
Antibody

NBP1-86088

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

OSBP2 Antibody

NBP1-81388

Species: Hu

Applications: ICC/IF, IHC, IHC-P

Recombinant Human
Enamelin GST (N-Term) ...

H00010117-Q01

(1 Publication)

Species: Hu

Applications: ELISA, AP, PA, WB

GRB2 Antibody
[Unconjugated]

AF3846

Immunohistochemistry GRB2 Antibody [Unconjugated]

(2 Publications)

Species: Hu, Mu, Rt

Applications: IHC, WB

beta-Galactosidase-1/G ...

NBP2-45731

Immunohistochemistry beta-Galactosidase-1/GLB1 Antibody (OTI1C9)

(6 Publications)

Species: Ca, Hu, Pm

Applications: IHC, IHC-P, WB

RGS4 Antibody
(HL1522) - Azide and ...

NBP3-25636

Immunocytochemistry/ Immunofluorescence RGS4 Antibody (HL1522) - Azide and BSA Free

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

ArgRS Antibody

NBP2-31923

Immunocytochemistry/ Immunofluorescence ArgRS Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P

Dihydrolipoamide
Dehydrogenase/DLD Ant ...

NBP1-31302

Western Blot Dihydrolipoamide Dehydrogenase/DLD Antibody

(1 Review)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, KO, WB

ALDH9A1 Antibody

NBP1-89150

Immunohistochemistry-Paraffin ALDH9A1 Antibody

(3 Publications)

Species: Hu, Rt

Applications: IHC, IHC-P, WB

ILT6/CD85e/LILRA3
Antibody (2E9)

H00011026-M01

(6 Publications)

Species: Hu

Applications: ELISA, WB

Ameloblastin
Antibody

AF3026

(2 Publications)

Species: Mu

Applications: WB

UBR1 Antibody (2F5)

H00197131-M01

(2 Publications)

Species: Hu, Mu

Applications: ELISA, ICC/IF, IHC, IHC-Fr, S-ELISA, WB

Calreticulin
Antibody - BSA Free

NB600-101

Immunocytochemistry/ Immunofluorescence Calreticulin Antibody - BSA Free

(28 Publications)

Species: Bv, Ha, Hu, Mu, Pm, Rt

Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB

RGS16 Antibody
(OTI4E5)

NBP2-01584

Immunohistochemistry-Paraffin RGS16 Antibody (OTI4E5)

(1 Publication)

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

DNAM-1/CD226
Antibody (102511) [Un ...

MAB666

Neutralization DNAM-1/CD226 Antibody (102511) [Unconjugated]

(1 Review)

(10 Publications)

Species: Hu

Applications: CyTOF-ready, Flow, Neut, WB

ELOF1 Antibody

NBP1-91868

Immunocytochemistry/ Immunofluorescence ELOF1 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P

RGS5 Antibody
(OTI1C1)

NBP2-00880

Immunohistochemistry-Paraffin RGS5 Antibody (OTI1C1)

(4 Publications)

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

CD5 Antibody
(OTI7A7) - Azide and ...

NBP2-70360

Flow Cytometry CD5 Antibody (OTI7A7) - Azide and BSA Free

(1 Review)

Species: Hu

Applications: CyTOF-ready, Flow, IMC, ICC/IF, IHC, IHC-P, WB

SHQ1 Antibody

NBP1-92388

(1 Publication)

Species: Hu

Applications: ICC/IF, WB

ATE1 Antibody (2B6)

H00011101-M01

Species: Hu

Applications: WB, ELISA, ICC/IF

Publications for ATE1 Antibody (H00011101-M01) (0)

There are no publications for ATE1 Antibody (H00011101-M01).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATE1 Antibody (H00011101-M01) (0)

There are no reviews for ATE1 Antibody (H00011101-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

ICC/IF Video Protocol

FAQs for ATE1 Antibody (H00011101-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

Isotype Controls

Additional ATE1 Products

Blogs on ATE1

There are no specific blogs for ATE1, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western blot shows detection of Mouse Anti-Human/Mouse/Rat STAT3 Monoclonal Antibody (MAB1799) using a 1:1000 dilution of HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.

Goat anti-Mouse IgG Secondary Antibody [HRP]
HAF007

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our ATE1 Antibody (2B6) and receive a gift card or discount.

Bioinformatics

Gene Symbol	ATE1
Entrez	11101(Human)
Uniprot	NP_001001976(Human)

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

ATE1 Antibody (2B6)

Species Glossary

Images

Product Details

Order Details

ATE1 Antibody (2B6) Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for ATE1 Antibody (2B6)

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for ATE1 Antibody (H00011101-M01) (0)

Reviews for ATE1 Antibody (H00011101-M01) (0)

Product General Protocols

Video Protocols

FAQs for ATE1 Antibody (H00011101-M01) (0)

Secondary Antibodies

Isotype Controls

Additional ATE1 Products

Blogs on ATE1

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics