Home » ARL2BP » ARL2BP Proteins » ARL2BP Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ARL2BP Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ARL2BP Protein (NBP2-30477PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ARL2BP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ARL2BP.

Source: E. coli

Amino Acid Sequence: MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ARL2BP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-30477.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ARL2BP Recombinant Protein Antigen

  • ADP-ribosylation factor-like 2 binding protein
  • ADP-ribosylation factor-like protein 2-binding protein
  • ARF-like 2-binding protein
  • BART1binder of Arl Two
  • BARTArf-like 2 binding protein BART1
  • Binder of ARF2 protein 1
  • binder of Arl2

Background

ADP-ribosylation factor (ARF)-like proteins (ARLs) comprise a functionally distinct group of the ARF family of RAS-related GTPases. The protein encoded by this gene binds to ARL2.GTP with high affinity but does not interact with ARL2.GDP, activated ARF, or RHO proteins. The lack of detectable membrane association of this protein or ARL2 upon activation of ARL2 is suggestive of actions distinct from those of the ARFs. This protein is considered to be the first ARL2-specific effector identified, due to its interaction with ARL2.GTP but lack of ARL2 GTPase-activating protein activity. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ARL2 Antibody
NB100-1078
Western Blot ARL2 Antibody
Immunocytochemistry/ Immunofluorescence ARL2 Antibody
Flow Cytometry ARL2 Antibody
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA, WB
Adenine Nucleotide
Translocase 1 Antibod ...
NBP2-92642
Immunocytochemistry/ Immunofluorescence Adenine Nucleotide Translocase 1 Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence Adenine Nucleotide Translocase 1 Antibody - Azide and BSA Free
Knockout Validated Adenine Nucleotide Translocase 1 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KO, WB
Rhodopsin Antibody
(4D2)
NBP2-59690
Immunohistochemistry-Frozen Rhodopsin Antibody (4D2)
Western Blot Rhodopsin Antibody (4D2)
Immunohistochemistry Rhodopsin Antibody (4D2)
(1 Review)
(6 Publications)
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
RhoD Antibody
NBP1-58359
Immunohistochemistry-Paraffin RhoD Antibody
Western Blot RhoD Antibody
Immunohistochemistry RhoD Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Annexin A7 Antibody
AF3926
Western Blot Annexin A7 Antibody
Simple Western Annexin A7 Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB
CD24 Antibody
(ML5) - BSA Free
NB100-77903
Flow Cytometry CD24 Antibody (ML5) - BSA Free
Flow Cytometry CD24 Antibody (ML5) - BSA Free
Immunocytochemistry/ Immunofluorescence CD24 Antibody (ML5) - BSA Free
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr
G3BP1 Antibody
(2F3)
H00010146-M01
ELISA G3BP1 Antibody (2F3)
Immunocytochemistry/ Immunofluorescence G3BP1 Antibody (2F3)
Immunohistochemistry-Paraffin G3BP1 Antibody (2F3)
(8 Publications)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
PDLIM7 Antibody
NBP1-84841
Immunohistochemistry-Paraffin PDLIM7 Antibody
Immunocytochemistry/ Immunofluorescence PDLIM7 Antibody
Western Blot PDLIM7 Antibody
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PRPF6 Antibody
NBP1-92298
Immunocytochemistry/ Immunofluorescence PRPF6 Antibody
Immunohistochemistry-Paraffin PRPF6 Antibody
Immunohistochemistry-Paraffin PRPF6 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Acetyl-CoA
Carboxylase alpha/ACA ...
MAB6898
Western Blot Acetyl-CoA Carboxylase alpha/ACACA Antibody (738421)
(3 Publications)
Species: Hu, Mu
Applications: WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
CASZ1 Antibody
NBP1-86617
Immunohistochemistry-Paraffin CASZ1 Antibody
Immunocytochemistry/ Immunofluorescence CASZ1 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Western Blot c-Myc Antibody (9E10) - BSA Free
(4 Reviews)
(46 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Ceruloplasmin
Antibody (6C3K9)
NBP3-15868
Immunohistochemistry-Paraffin Ceruloplasmin Antibody (6C3K9)
Immunohistochemistry-Paraffin Ceruloplasmin Antibody (6C3K9)
Immunohistochemistry Ceruloplasmin Antibody (6C3K9)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
GAL3ST1 Antibody
H00009514-B01P
Western Blot GAL3ST1 Antibody
(3 Publications)
Species: Hu, Mu
Applications: WB
Hemoglobin A2
Antibody - BSA Free
NBP3-05569
Western Blot Hemoglobin A2 Antibody - BSA Free
Immunohistochemistry Hemoglobin A2 Antibody - BSA Free
Immunohistochemistry Hemoglobin A2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Orexin
A/Hypocretin-1 Antibo ...
MAB763
Immunohistochemistry Orexin A/Hypocretin-1 Antibody (97505) [Unconjugated]
(19 Publications)
Species: Hu, Mu
Applications: IHC
Hemoglobin alpha
Antibody - BSA Free
NB110-41083
Hemoglobin alpha Antibody - BSA Free
(12 Publications)
Species: Hu
Applications: ChIP, ELISA, ICC/IF, WB

Publications for ARL2BP Protein (NBP2-30477PEP) (0)

There are no publications for ARL2BP Protein (NBP2-30477PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARL2BP Protein (NBP2-30477PEP) (0)

There are no reviews for ARL2BP Protein (NBP2-30477PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ARL2BP Protein (NBP2-30477PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARL2BP Products

Research Areas for ARL2BP Protein (NBP2-30477PEP)

Find related products by research area.

Blogs on ARL2BP

There are no specific blogs for ARL2BP, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on U-937 cells with c-Myc Antibody (9E10) NB600-302AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
c-Myc Antibody (9E10) - BSA Free
NB600-302
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
p19ARF/CDKN2A Antibody - BSA Free
NB200-106

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ARL2BP Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ARL2BP