![Immunohistochemistry-Paraffin: Aquaporin 1/AQP1 Antibody [NBP1-84488] - Analysis in human kidney and liver tissues. Corresponding AQP1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Aquaporin-1-AQP1-Antibody-Immunohistochemistry-Paraffin-NBP1-84488-img0024.jpg "Immunohistochemistry-Paraffin: Aquaporin 1/AQP1 Antibody [NBP1-84488] - Analysis in human kidney and liver tissues. Corresponding AQP1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, Fe, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK |
| Predicted Species | Rat (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | AQP1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Verified Customer |
IHC-P | Feline | 05/11/2022 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Aquaporin 1/AQP1 Antibody (NBP1-84488)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | AQP1 |
![Western Blot: Aquaporin 1/AQP1 Antibody [NBP1-84488] - Analysis in control (vector only transfected HEK293T lysate) and aQP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/Aquaporin-1-AQP1-Antibody-Western-Blot-NBP1-84488-img0022.jpg "Western Blot: Aquaporin 1/AQP1 Antibody [NBP1-84488] - Analysis in control (vector only transfected HEK293T lysate) and aQP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunocytochemistry/Immunofluorescence: Aquaporin 1/AQP1 Antibody [NBP1-84488] - Staining of human cell line U-2 OS shows localization to plasma membrane. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Aquaporin-1-AQP1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84488-img0023.jpg "Immunocytochemistry/Immunofluorescence: Aquaporin 1/AQP1 Antibody [NBP1-84488] - Staining of human cell line U-2 OS shows localization to plasma membrane. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Aquaporin 1/AQP1 Antibody [NBP1-84488] - Aquaporin 1/AQP1 used at 1:50 on a feline cornea tissue. Aquaporin 1/AQP1 antibody was used on feline paraffin-embedded cornea tissue at a concentration of 20ug/mL and left at 4C overnight. HIER was performed in Tris/EDTA buffer for two hours at 75C. Image from verified customer review.](http://images.novusbio.com/fullsize/Aquaporin-1-AQP1-Antibody-Immunohistochemistry-Paraffin-NBP1-84488-img0029.jpg "Immunohistochemistry-Paraffin: Aquaporin 1/AQP1 Antibody [NBP1-84488] - Aquaporin 1/AQP1 used at 1:50 on a feline cornea tissue. Aquaporin 1/AQP1 antibody was used on feline paraffin-embedded cornea tissue at a concentration of 20ug/mL and left at 4C overnight. HIER was performed in Tris/EDTA buffer for two hours at 75C. Image from verified customer review.")
![Immunohistochemistry-Paraffin: Aquaporin 1/AQP1 Antibody [NBP1-84488] - Staining of human lung shows strong membranous positivity in endothelial cells.](http://images.novusbio.com/fullsize/Aquaporin-1-AQP1-Antibody-Immunohistochemistry-Paraffin-NBP1-84488-img0025.jpg "Immunohistochemistry-Paraffin: Aquaporin 1/AQP1 Antibody [NBP1-84488] - Staining of human lung shows strong membranous positivity in endothelial cells.")
![Immunohistochemistry-Paraffin: Aquaporin 1/AQP1 Antibody [NBP1-84488] - Staining of human kidney shows moderate to strong positivity in apical membranes in cells in tubules.](http://images.novusbio.com/fullsize/Aquaporin-1-AQP1-Antibody-Immunohistochemistry-Paraffin-NBP1-84488-img0026.jpg "Immunohistochemistry-Paraffin: Aquaporin 1/AQP1 Antibody [NBP1-84488] - Staining of human kidney shows moderate to strong positivity in apical membranes in cells in tubules.")
![Immunohistochemistry-Paraffin: Aquaporin 1/AQP1 Antibody [NBP1-84488] - Staining of human rectum shows moderate positivity in apical membranes in glandular cells.](http://images.novusbio.com/fullsize/Aquaporin-1-AQP1-Antibody-Immunohistochemistry-Paraffin-NBP1-84488-img0028.jpg "Immunohistochemistry-Paraffin: Aquaporin 1/AQP1 Antibody [NBP1-84488] - Staining of human rectum shows moderate positivity in apical membranes in glandular cells.")
![Immunohistochemistry-Paraffin: Aquaporin 1/AQP1 Antibody [NBP1-84488] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/Aquaporin-1-AQP1-Antibody-Immunohistochemistry-Paraffin-NBP1-84488-img0027.jpg "Immunohistochemistry-Paraffin: Aquaporin 1/AQP1 Antibody [NBP1-84488] - Staining of human liver shows no positivity in hepatocytes as expected.")
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Western Blot VASA Antibody [Unconjugated]](https://images.novusbio.com/images2/VASA_AF2030_Western_Blot_16711.jpg)
![Immunohistochemistry VASA Antibody [Unconjugated]](https://images.novusbio.com/images2/VASA_AF2030_Immunohistochemistry_7144.jpg)
![Immunohistochemistry VASA Antibody [Unconjugated]](https://images.novusbio.com/images/af2030_human-vasa-affinity-purified-polyclonal-ab-4120241239493.jpg)
![Bioactivity GM-CSF [Unconjugated]](https://images.novusbio.com/images/protein/7954-gmcf_recombinant-human-gm-csf-cho-expressed-protein-cf-bioactivity-272020121514.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
