![Immunohistochemistry-Paraffin: AP-2 gamma Antibody [NBP2-49170] - Staining in human skin and skeletal muscle tissues using anti-TFAP2C antibody. Corresponding TFAP2C RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/AP-2-gamma-Antibody-Immunohistochemistry-Paraffin-NBP2-49170-img0006.jpg "Immunohistochemistry-Paraffin: AP-2 gamma Antibody [NBP2-49170] - Staining in human skin and skeletal muscle tissues using anti-TFAP2C antibody. Corresponding TFAP2C RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TFAP2C |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP2-49170 | Applications | Species |
|---|---|---|
| J Li, Q Zhu, J Cao, Y Liu, Y Lu, Y Sun, Q Li, Y Huang, S Shang, X Bian, C Li, L Zhang, Y Wang, Y Nie, J Fu, W Li, MA Mazid, Y Jiang, W Jia, X Wang, Y Sun, MA Esteban, Q Sun, F Zhou, Z Liu Cynomolgus monkey embryo model captures gastrulation and early pregnancy Cell Stem Cell, 2023-04-06;30(4):362-377.e7. 2023-04-06 [PMID: 37028403] (Immunohistochemistry, Primate - Macaca mulatta (Rhesus Macaque)) | Immunohistochemistry | Primate - Macaca mulatta (Rhesus Macaque) |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TFAP2C |
![Immunocytochemistry/Immunofluorescence: AP-2 gamma Antibody [NBP2-49170] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/AP-2-gamma-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-49170-img0003.jpg "Immunocytochemistry/Immunofluorescence: AP-2 gamma Antibody [NBP2-49170] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm.")
![Immunohistochemistry-Paraffin: AP-2 gamma Antibody [NBP2-49170] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/AP-2-gamma-Antibody-Immunohistochemistry-Paraffin-NBP2-49170-img0004.jpg "Immunohistochemistry-Paraffin: AP-2 gamma Antibody [NBP2-49170] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: AP-2 gamma Antibody [NBP2-49170] - Staining of human skin shows high expression.](http://images.novusbio.com/fullsize/AP-2-gamma-Antibody-Immunohistochemistry-Paraffin-NBP2-49170-img0005.jpg "Immunohistochemistry-Paraffin: AP-2 gamma Antibody [NBP2-49170] - Staining of human skin shows high expression.")
![Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Chromatin_Immunoprecipitation_11218.jpg)
![Immunocytochemistry Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Immunocytochemistry_7093.jpg)
![Simple Western Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct3_4_AF1759_Simple_Western_20183.jpg)
![SDS-PAGE ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/ErbB2_1129-ER_70.jpg)
![Bioactivity ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/1129-er_recombinant-human-erbb2-her2-fc-chimera-protein-cf-bioactivity-7122020142841.jpg)
![Immunocytochemistry FABP4/A-FABP Antibody [Unconjugated]](https://images.novusbio.com/images2/FABP4_AF1443_Immunocytochemistry_6471.jpg)
![Western Blot FABP4/A-FABP Antibody [Unconjugated]](https://images.novusbio.com/images2/FABP4_AF1443_Western_Blot_17166.jpg)
![Immunohistochemistry FABP4/A-FABP Antibody [Unconjugated]](https://images.novusbio.com/images2/FABP4_AF1443_Immunohistochemistry_7312.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Immunohistochemistry Ret Antibody [Unconjugated]](https://images.novusbio.com/images2/Ret_AF482_Immunohistochemistry_10194.jpg)
![Western Blot Ret Antibody [Unconjugated]](https://images.novusbio.com/images/af482_mouse-ret-affinity-purified-polyclonal-ab-8220249503265.jpg)
![Immunohistochemistry Ret Antibody [Unconjugated]](https://images.novusbio.com/images/af482_mouse-ret-affinity-purified-polyclonal-ab-8220249505961.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")