![Immunocytochemistry/Immunofluorescence: Annexin V Antibody [NBP2-38248] - Staining of human cell line PC-3 shows localization to nuclear membrane. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Annexin-V-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38248-img0004.jpg "Immunocytochemistry/Immunofluorescence: Annexin V Antibody [NBP2-38248] - Staining of human cell line PC-3 shows localization to nuclear membrane. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAG |
| Predicted Species | Mouse (95%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ANXA5 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
| Publication using NBP2-38248 | Applications | Species |
|---|---|---|
| Herrera-López EE, Guerrero-Escalera D, Aguirre-Maldonado I et al. Annexins A2 and A5 are potential early biomarkers of hepatocarcinogenesis Scientific reports 2023-04-28 [PMID: 37117324] (IHC-P, Rat) | IHC-P | Rat |
Secondary Antibodies |
Isotype Controls |
Research Areas for Annexin V Antibody (NBP2-38248)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Annexin V Antibody [NBP2-38248] - Staining of human prostate shows moderate membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/Annexin-V-Antibody-Immunohistochemistry-Paraffin-NBP2-38248-img0009.jpg "Immunohistochemistry-Paraffin: Annexin V Antibody [NBP2-38248] - Staining of human prostate shows moderate membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Annexin V Antibody [NBP2-38248] - Analysis in human placenta and skeletal muscle tissues. Corresponding ANXA5 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Annexin-V-Antibody-Immunohistochemistry-Paraffin-NBP2-38248-img0006.jpg "Immunohistochemistry-Paraffin: Annexin V Antibody [NBP2-38248] - Analysis in human placenta and skeletal muscle tissues. Corresponding ANXA5 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Annexin V Antibody [NBP2-38248] - Staining of human skeletal muscle shows low positivity in myocytes as expected.](http://images.novusbio.com/fullsize/Annexin-V-Antibody-Immunohistochemistry-Paraffin-NBP2-38248-img0007.jpg "Immunohistochemistry-Paraffin: Annexin V Antibody [NBP2-38248] - Staining of human skeletal muscle shows low positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: Annexin V Antibody [NBP2-38248] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/Annexin-V-Antibody-Immunohistochemistry-Paraffin-NBP2-38248-img0008.jpg "Immunohistochemistry-Paraffin: Annexin V Antibody [NBP2-38248] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: Annexin V Antibody [NBP2-38248] - Staining of human fallopian tube shows moderate positivity in cilia in glandular cells.](http://images.novusbio.com/fullsize/Annexin-V-Antibody-Immunohistochemistry-Paraffin-NBP2-38248-img0010.jpg "Immunohistochemistry-Paraffin: Annexin V Antibody [NBP2-38248] - Staining of human fallopian tube shows moderate positivity in cilia in glandular cells.")
![Western Blot: Annexin V Antibody [NBP2-38248] - Analysis in human cell line SK-MEL-30.](http://images.novusbio.com/fullsize/antibody/nbp2-38248_rabbit-polyclonal-annexin-v-antibody-western-blot-217202392043..jpg "Western Blot: Annexin V Antibody [NBP2-38248] - Analysis in human cell line SK-MEL-30.")
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")