Ankyrin 1 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: FVLVSDKHRMSFPETVDEILDVSEDEGEELISFKAERRDSRDVDEEKELLDFVPKLDQVVESPAIPRIPCAMPETVVIRSEEQEQASKEYDEDSLIPSSP |
Predicted Species |
Mouse (90%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ANK1 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Rat (83%)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for Ankyrin 1 Antibody
Background
Ankyrins are a family of proteins that link the integral membrane proteins to the underlying spectrin-actincytoskeleton and play key roles in activities such as cell motility, activation, proliferation, contact and themaintenance of specialized membrane domains. Multiple isoforms of ankyrin with different affinities for various targetproteins are expressed in a tissue-specific, developmentally regulated manner. Most ankyrins are typically composed ofthree structural domains: an amino-terminal domain containing multiple ankyrin repeats; a central region with a highlyconserved spectrin binding domain; and a carboxy-terminal regulatory domain which is the least conserved and subjectto variation. Ankyrin 1, the prototype of this family, was first discovered in the erythrocytes, but since has alsobeen found in brain and muscles. Mutations in erythrocytic ankyrin 1 have been associated in approximately half of allpatients with hereditary spherocytosis. Complex patterns of alternative splicing in the regulatory domain, giving riseto different isoforms of ankyrin 1 have been described. Truncated muscle-specific isoforms of ankyrin 1 resulting fromusage of an alternate promoter have also been identified. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ch, Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu
Applications: ICC
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Gp, Hu, Mu, Rt, Ze
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Publications for Ankyrin 1 Antibody (NBP2-33806) (0)
There are no publications for Ankyrin 1 Antibody (NBP2-33806).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Ankyrin 1 Antibody (NBP2-33806) (0)
There are no reviews for Ankyrin 1 Antibody (NBP2-33806).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Ankyrin 1 Antibody (NBP2-33806) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Ankyrin 1 Products
Blogs on Ankyrin 1