Home » Aminoacylase/ACY1 » Aminoacylase/ACY1 Proteins » Aminoacylase/ACY1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Aminoacylase/ACY1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Aminoacylase/ACY1 Protein (NBP2-14261PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Aminoacylase/ACY1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ACY1.

Source: E. coli

Amino Acid Sequence: QGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFRE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ACY1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14261.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Aminoacylase/ACY1 Recombinant Protein Antigen

  • ACY1
  • ACY-1
  • ACY1D
  • acylase
  • aminoacylase 1
  • Aminoacylase
  • aminoacylase-1
  • EC 3.5.1
  • EC 3.5.1.14
  • N-acyl-L-amino-acid amidohydrolase

Background

Aminoacylase-1 is a cytosolic, homodimeric, zinc-binding enzyme that catalyzes the hydrolysis of acylated L-amino acids to L-amino acids and acyl group, and has been postulated to function in the catabolism and salvage of acylated amino acids. ACY1 has been assigned to chromosome 3p21.1, a region reduced to homozygosity in small-cell lung cancer (SCLC), and its expression has been reported to be reduced or undetectable in SCLC cell lines and tumors. The amino acid sequence of human aminoacylase-1 is highly homologous to the porcine counterpart, and ACY1 is the first member of a new family of zinc-binding enzymes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry-Paraffin Glutaminyl-peptide Cyclotransferase/QPCT Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Pancreatic Amylase
Alpha Antibody (OTI6D ...
NBP1-47659
Immunohistochemistry-Paraffin Pancreatic Amylase Alpha Antibody (OTI6D4)
Immunohistochemistry-Paraffin Pancreatic Amylase Alpha Antibody (OTI6D4)
Immunohistochemistry-Paraffin Pancreatic Amylase Alpha Antibody (OTI6D4)
(1 Review)
Species: Hu
Applications: IHC, IHC-P, WB
Recombinant Human
PRH2 GST (N-Term) Pro ...
H00005555-P01
SDS-PAGE Recombinant Human PRH2 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Pallidin Antibody
(OTI1H9)
NBP2-01763
Western Blot Pallidin Antibody (OTI1H9)
Flow Cytometry Pallidin Antibody (OTI1H9)
Immunohistochemistry-Paraffin Pallidin Antibody (OTI1H9)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Recombinant Human
PRH1 His Protein
NBP2-23368
SDS-PAGE Recombinant Human PRH1 His Protein
Species: Hu
Applications: PAGE
EPB42 Antibody
(2G12)
H00002038-M01
Western Blot EPB42 Antibody (2G12)
ELISA EPB42 Antibody (2G12)
Immunocytochemistry/ Immunofluorescence EPB42 Antibody (2G12)
Species: Hu
Applications: ELISA, ICC/IF, WB
GLYAT Antibody
NBP2-58917
Western Blot GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
CRAT Antibody
NBP1-86616
Western Blot CRAT Antibody
Western Blot CRAT Antibody
Immunohistochemistry-Paraffin CRAT Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB

beta-Galactosidase-1/G ...
NBP2-45731
Western Blot beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
Immunohistochemistry beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
Immunohistochemistry beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
(6 Publications)
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
DAO Antibody -
Azide and BSA Free
NBP2-92892
Immunocytochemistry/ Immunofluorescence DAO Antibody - Azide and BSA Free
Western Blot DAO Antibody - Azide and BSA Free
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
LAP3 Antibody
NBP1-82847
Immunohistochemistry-Paraffin LAP3 Antibody
Immunohistochemistry-Paraffin LAP3 Antibody
Immunohistochemistry-Paraffin LAP3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Inorganic
Pyrophosphatase/PPA1
NBP1-31348
Immunocytochemistry/ Immunofluorescence Inorganic Pyrophosphatase/PPA1 Antibody
Western Blot Inorganic Pyrophosphatase/PPA1 Antibody
Western Blot Inorganic Pyrophosphatase/PPA1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ESD Antibody
NBP2-16374
Immunohistochemistry-Paraffin ESD Antibody
Western Blot ESD Antibody
Western Blot ESD Antibody
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
APEH Antibody
NBP1-85333
Immunocytochemistry/ Immunofluorescence APEH Antibody
Immunohistochemistry-Paraffin APEH Antibody
Immunohistochemistry-Paraffin APEH Antibody
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
ASPA Antibody
NBP1-31754
Immunocytochemistry/ Immunofluorescence ASPA Antibody
Western Blot ASPA Antibody
Western Blot ASPA Antibody
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
ACP2 Antibody
(M1-4A12)
H00000053-M01
Western Blot ACP2 Antibody (M1-4A12)
ELISA ACP2 Antibody (M1-4A12)
Western Blot ACP2 Antibody (M1-4A12)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
RPL29 Antibody
NBP3-12600
Western Blot RPL29 Antibody
Immunohistochemistry-Paraffin RPL29 Antibody
Immunohistochemistry-Paraffin RPL29 Antibody
Species: Hu
Applications: ICC/IF, IHC-P, IP, WB
Aminoacylase/ACY1
Recombinant Protein A ...
NBP2-14261PEP
Aminoacylase/ACY1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Aminoacylase/ACY1 Protein (NBP2-14261PEP) (0)

There are no publications for Aminoacylase/ACY1 Protein (NBP2-14261PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aminoacylase/ACY1 Protein (NBP2-14261PEP) (0)

There are no reviews for Aminoacylase/ACY1 Protein (NBP2-14261PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Aminoacylase/ACY1 Protein (NBP2-14261PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Aminoacylase/ACY1 Products

Blogs on Aminoacylase/ACY1

There are no specific blogs for Aminoacylase/ACY1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Aminoacylase/ACY1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ACY1