![Western Blot: Aldehyde dehydrogenase 5 Antibody [NBP1-90192] - Analysis in human cell line RH-30.](http://images.novusbio.com/fullsize/Aldehyde-dehydrogenase-5-Antibody-Western-Blot-NBP1-90192-img0012.jpg "Western Blot: Aldehyde dehydrogenase 5 Antibody [NBP1-90192] - Analysis in human cell line RH-30.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MLRFLAPRLLSLQGRTARYSSAAALPSPILNPDIPYNQLFINNEWQDAVSKKTFPTVNPTTGEVIGHV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ALDH1B1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Aldehyde dehydrogenase 5 Antibody (NBP1-90192)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ALDH1B1 |
![Immunocytochemistry/Immunofluorescence: Aldehyde dehydrogenase 5 Antibody [NBP1-90192] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.](http://images.novusbio.com/fullsize/Aldehyde-dehydrogenase-5-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90192-img0006.jpg "Immunocytochemistry/Immunofluorescence: Aldehyde dehydrogenase 5 Antibody [NBP1-90192] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.")
![Immunohistochemistry-Paraffin: Aldehyde dehydrogenase 5 Antibody [NBP1-90192] - Staining of human tonsil shows weak granular cytoplasmic positivity in non-germinal center cells.](http://images.novusbio.com/fullsize/Aldehyde-dehydrogenase-5-Antibody-Immunohistochemistry-Paraffin-NBP1-90192-img0011.jpg "Immunohistochemistry-Paraffin: Aldehyde dehydrogenase 5 Antibody [NBP1-90192] - Staining of human tonsil shows weak granular cytoplasmic positivity in non-germinal center cells.")
![Western Blot: Aldehyde dehydrogenase 5 Antibody [NBP1-90192] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://images.novusbio.com/fullsize/Aldehyde-dehydrogenase-5-Antibody-Western-Blot-NBP1-90192-img0005.jpg "Western Blot: Aldehyde dehydrogenase 5 Antibody [NBP1-90192] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue")
![Immunohistochemistry-Paraffin: Aldehyde dehydrogenase 5 Antibody [NBP1-90192] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes and bile duct cells.](http://images.novusbio.com/fullsize/Aldehyde-dehydrogenase-5-Antibody-Immunohistochemistry-Paraffin-NBP1-90192-img0002.jpg "Immunohistochemistry-Paraffin: Aldehyde dehydrogenase 5 Antibody [NBP1-90192] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes and bile duct cells.")
![Immunohistochemistry-Paraffin: Aldehyde dehydrogenase 5 Antibody [NBP1-90192] - Analysis in human liver and tonsil tissues using NBP1-90192 antibody. Corresponding ALDH1B1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Aldehyde-dehydrogenase-5-Antibody-Immunohistochemistry-Paraffin-NBP1-90192-img0007.jpg "Immunohistochemistry-Paraffin: Aldehyde dehydrogenase 5 Antibody [NBP1-90192] - Analysis in human liver and tonsil tissues using NBP1-90192 antibody. Corresponding ALDH1B1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Aldehyde dehydrogenase 5 Antibody [NBP1-90192] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/Aldehyde-dehydrogenase-5-Antibody-Immunohistochemistry-Paraffin-NBP1-90192-img0008.jpg "Immunohistochemistry-Paraffin: Aldehyde dehydrogenase 5 Antibody [NBP1-90192] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: Aldehyde dehydrogenase 5 Antibody [NBP1-90192] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/Aldehyde-dehydrogenase-5-Antibody-Immunohistochemistry-Paraffin-NBP1-90192-img0009.jpg "Immunohistochemistry-Paraffin: Aldehyde dehydrogenase 5 Antibody [NBP1-90192] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: Aldehyde dehydrogenase 5 Antibody [NBP1-90192] - Staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/Aldehyde-dehydrogenase-5-Antibody-Immunohistochemistry-Paraffin-NBP1-90192-img0010.jpg "Immunohistochemistry-Paraffin: Aldehyde dehydrogenase 5 Antibody [NBP1-90192] - Staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons.")
![Immunocytochemistry Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aldehyde_Dehydrogenase_1-A1_AF5869_Immunocytochemistry_10308.jpg)
![Immunohistochemistry Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aldehyde_Dehydrogenase_1-A1_AF5869_Immunohistochemistry_10638.jpg)
![Simple Western Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aldehyde_Dehydrogenase_1A1_AF5869_Simple_Western_17067.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")