![Western Blot: AGPS Antibody [NBP1-89241] - Analysis using Anti-AGPS antibody NBP1-89241 (A) shows similar pattern to independent antibody NBP1-89242 (B).](http://images.novusbio.com/fullsize/AGPS-Antibody-Western-Blot-NBP1-89241-img0009.jpg "Western Blot: AGPS Antibody [NBP1-89241] - Analysis using Anti-AGPS antibody NBP1-89241 (A) shows similar pattern to independent antibody NBP1-89242 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KERITRECKEKGVQFAPFSTCRVTQTYDAGACIYFYFAFNYRGISDPLTVFEQTEAAAREEILANGGSLSHHHGVGKLRKQWLKESISDVGFGMLKS |
| Predicted Species | Mouse (95%), Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | AGPS |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Simple_Western_21377.jpg)
![Western Blot CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Western_Blot_21459.jpg)
![Immunohistochemistry CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Immunohistochemistry_17361.jpg)
![Neutralization VEGFR2/KDR/Flk-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/VEGF_R2_AF644_Block_Neutralize_1519.jpg)
![Immunohistochemistry VEGFR2/KDR/Flk-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/VEGF_R2_AF644_Immunohistochemistry_22159.jpg)
![Immunohistochemistry VEGFR2/KDR/Flk-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/VEGF_R2_AF644_Immunohistochemistry_6888.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | AGPS |
![Immunocytochemistry/Immunofluorescence: AGPS Antibody [NBP1-89241] - Staining of human cell line A-431 shows localization to nucleoli & peroxisomes.](http://images.novusbio.com/fullsize/AGPS-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89241-img0006.jpg "Immunocytochemistry/Immunofluorescence: AGPS Antibody [NBP1-89241] - Staining of human cell line A-431 shows localization to nucleoli & peroxisomes.")
![Immunohistochemistry-Paraffin: AGPS Antibody [NBP1-89241] - Staining of human skeletal muscle shows weak granular cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/AGPS-Antibody-Immunohistochemistry-Paraffin-NBP1-89241-img0016.jpg "Immunohistochemistry-Paraffin: AGPS Antibody [NBP1-89241] - Staining of human skeletal muscle shows weak granular cytoplasmic positivity in myocytes.")
![Western Blot: AGPS Antibody [NBP1-89241] - Analysis in human cell line U-2 OS.](http://images.novusbio.com/fullsize/AGPS-Antibody-Western-Blot-NBP1-89241-img0008.jpg "Western Blot: AGPS Antibody [NBP1-89241] - Analysis in human cell line U-2 OS.")
![Immunohistochemistry-Paraffin: AGPS Antibody [NBP1-89241] - Staining of human gastrointestinal shows moderate granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/AGPS-Antibody-Immunohistochemistry-Paraffin-NBP1-89241-img0012.jpg "Immunohistochemistry-Paraffin: AGPS Antibody [NBP1-89241] - Staining of human gastrointestinal shows moderate granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: AGPS Antibody [NBP1-89241] - Staining of human endometrium shows moderate granular cytoplasm positivity in glandular cells.](http://images.novusbio.com/fullsize/AGPS-Antibody-Immunohistochemistry-Paraffin-NBP1-89241-img0014.jpg "Immunohistochemistry-Paraffin: AGPS Antibody [NBP1-89241] - Staining of human endometrium shows moderate granular cytoplasm positivity in glandular cells.")
![Immunohistochemistry-Paraffin: AGPS Antibody [NBP1-89241] - Staining of human gastrointestinal shows moderate granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/AGPS-Antibody-Immunohistochemistry-Paraffin-NBP1-89241-img0015.jpg "Immunohistochemistry-Paraffin: AGPS Antibody [NBP1-89241] - Staining of human gastrointestinal shows moderate granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: AGPS Antibody [NBP1-89241] - Staining of human testis shows moderate granular cytoplasmic positivity in spermatogonia.](http://images.novusbio.com/fullsize/AGPS-Antibody-Immunohistochemistry-Paraffin-NBP1-89241-img0017.jpg "Immunohistochemistry-Paraffin: AGPS Antibody [NBP1-89241] - Staining of human testis shows moderate granular cytoplasmic positivity in spermatogonia.")
![Western Blot Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Western_Blot_19121.jpg)
![Immunohistochemistry Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Immunohistochemistry_19158.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Bioactivity GM-CSF [Unconjugated]](https://images.novusbio.com/images/protein/7954-gmcf_recombinant-human-gm-csf-cho-expressed-protein-cf-bioactivity-272020121514.jpg)
![Immunohistochemistry CD34 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD34_AF4117_Immunohistochemistry_6824.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")