Home » AGA » AGA Proteins » AGA Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

AGA Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for AGA Protein (NBP1-88865PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

AGA Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AGA.

Source: E. coli

Amino Acid Sequence: DELGETTLDAMIMDGTTMDVGAVGDLRRIKNAIGVARKVLEHTTHTLLVGESATTFAQSMGFINEDLSTSASQALHSDWLARN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AGA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88865.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for AGA Recombinant Protein Antigen

  • AGU
  • aspartylglucosaminidase
  • aspartylglucosylamine deaspartylase
  • ASRG
  • EC 3.5.1
  • EC 3.5.1.26
  • GA
  • glycosylasparaginase
  • N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase
  • N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase

Background

Aspartylglucosaminidase is involved in the catabolism of N-linked oligosaccharides of glycoproteins. It cleaves asparagine from N-acetylglucosamines as one of the final steps in the lysosomal breakdown of glycoproteins. The lysosomal storage disease aspartylglycosaminuria is caused by a deficiency in the AGA enzyme. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TEAD1 Antibody -
Azide and BSA Free
NBP2-94035
Chromatin Immunoprecipitation TEAD1 Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence TEAD1 Antibody - Azide and BSA Free
Western Blot TEAD1 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(808 Publications)
Species: Hu
Applications: BA
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
HSP90 alpha
Antibody
NB120-2928
Immunohistochemistry HSP90 alpha Antibody
Immunohistochemistry HSP90 alpha Antibody
Immunohistochemistry-Paraffin HSP90 alpha Antibody
(12 Publications)
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC, IHC-P, IP, WB
IGF-I/IGF-1
[Unconjugated]
291-G1
SDS-PAGE IGF-I/IGF-1 [Unconjugated]
Bioactivity IGF-I/IGF-1 [Unconjugated]
Mass Spectrometry IGF-I/IGF-1 [Unconjugated]
(219 Publications)
Species: Hu
Applications: BA
IL-10 [Biotin]
DY417
N/A IL-10 [Biotin]
(291 Publications)
Species: Mu
Applications: ELISA
CD55/DAF Antibody
[Unconjugated]
AF2009
Immunohistochemistry CD55/DAF Antibody [Unconjugated]
Immunocytochemistry CD55/DAF Antibody [Unconjugated]
(8 Publications)
Species: Hu
Applications: ICC, IHC
Integrin alpha
2b/CD41 Antibody (745 ...
MAB7616
Western Blot Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]
Flow Cytometry Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]
Flow Cytometry Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]
(6 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, WB
Pancreatic Amylase
Alpha Antibody (OTI6D ...
NBP1-47659
Immunohistochemistry-Paraffin Pancreatic Amylase Alpha Antibody (OTI6D4)
Immunohistochemistry-Paraffin Pancreatic Amylase Alpha Antibody (OTI6D4)
Immunohistochemistry-Paraffin Pancreatic Amylase Alpha Antibody (OTI6D4)
(1 Review)
Species: Hu
Applications: IHC, IHC-P, WB
FABP6 Antibody
[Unconjugated]
AF3880
Immunocytochemistry FABP6 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: ICC, WB
Integrin beta
3/CD61 Antibody (SJ19
NBP2-67416
Immunocytochemistry/ Immunofluorescence Integrin beta 3/CD61 Antibody (SJ19-09)
Immunocytochemistry/ Immunofluorescence Integrin beta 3/CD61 Antibody (SJ19-09)
Immunohistochemistry-Paraffin Integrin beta 3/CD61 Antibody (SJ19-09)
(2 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Transcobalamin II
Antibody
AF7895
Western Blot Transcobalamin II Antibody
Immunohistochemistry Transcobalamin II Antibody
Species: Hu
Applications: IHC, WB
GLS2 Antibody -
BSA Free
NBP1-76544
Western Blot GLS2 Antibody - BSA Free
Immunohistochemistry GLS2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence GLS2 Antibody - BSA Free
(7 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
Sialin/SLC17A5
Antibody
NBP2-20383
Immunohistochemistry-Paraffin Sialin/SLC17A5 Antibody
Western Blot Sialin/SLC17A5 Antibody
Immunocytochemistry/ Immunofluorescence Sialin/SLC17A5 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Leptin/OB [HRP]
DLP00
N/A Leptin/OB [HRP]
N/A Leptin/OB [HRP]
(151 Publications)
Species: Hu
Applications: ELISA
RanGAP1 Antibody
(OTI1B4)
NBP2-02623
Flow Cytometry RanGAP1 Antibody (OTI1B4)
Flow Cytometry RanGAP1 Antibody (OTI1B4)
Flow Cytometry RanGAP1 Antibody (OTI1B4)
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for AGA Protein (NBP1-88865PEP) (0)

There are no publications for AGA Protein (NBP1-88865PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AGA Protein (NBP1-88865PEP) (0)

There are no reviews for AGA Protein (NBP1-88865PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for AGA Protein (NBP1-88865PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AGA Products

Array NBP1-88865PEP

Research Areas for AGA Protein (NBP1-88865PEP)

Find related products by research area.

Blogs on AGA

There are no specific blogs for AGA, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our AGA Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol AGA