ADCY4 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: FAHLSHGDSPVSTSTPLPEKTLASFSTQWSLDRSRTPRGLDDELDTGDAKFFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSAIP |
Predicted Species |
Mouse (90%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ADCY4 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for ADCY4 Antibody
Background
Adenylyl cyclases function to convert ATP to cyclic AMP in response to activation by a variety of hormones, neurotransmitters and other regulatory molecules. Cyclic AMP, in turn, activates several other target molecules to control a broad range of diverse phenomena such as metabolism, gene transcription and memory. Adenylyl cyclases respond to receptor-initiated signals, mediated by the Gs and Gi heterotrimeric G proteins. The binding of an agonist to a Gs-coupled receptor catalyzes the exchange of GDP (bound to Galpha s) for GTP, the dissociation of GTP-Galpha s from Gbetagamma and Galpha s-mediated activation of adenylyl cyclase. Adenylyl cyclase IV (AC IV) and IX mRNA are expressed in all kidney nephron segments. AC IV exhibits moderate staining in type II and type IV fibrocytes in rat cochlea and immunoreactivity is also observed in type I fibrocytes. Activation of the D2 dopaminergic and m4 muscarine receptors inhibits the activity of adenylyl cyclase isozymes I, V, VI and VIII, whereas type II, IV and VII are stimulated and type III is not affected.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Mu, Rb, Rt
Applications: ELISA, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Bv, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Pm, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Publications for ADCY4 Antibody (NBP2-37920) (0)
There are no publications for ADCY4 Antibody (NBP2-37920).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ADCY4 Antibody (NBP2-37920) (0)
There are no reviews for ADCY4 Antibody (NBP2-37920).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for ADCY4 Antibody (NBP2-37920) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ADCY4 Products
Research Areas for ADCY4 Antibody (NBP2-37920)
Find related products by research area.
|
Blogs on ADCY4