Note: Mouseover a species abbreviation on the product page to display the fullname.
Images
Orthogonal Strategies: Immunohistochemistry-Paraffin: ACRBP Antibody [NBP1-85407] - Staining in human testis and endometrium tissues using anti-ACRBP antibody. Corresponding ACRBP RNA-seq data are presented for ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: ACRBP Antibody [NBP1-85407] - Staining in human testis and endometrium tissues using anti-ACRBP antibody. Corresponding ACRBP RNA-seq data are presented for ...read more
Western Blot: ACRBP Antibody [NBP1-85407] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: ACRBP Antibody [NBP1-85407] - Staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ACRBP Antibody [NBP1-85407] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: ACRBP Antibody [NBP1-85407] - Staining of human testis shows high expression.
This antibody was developed against Recombinant Protein corresponding to amino acids: AKRVLCSQPVSILSPNTLKEIEASAEVSPTTMTSPISPHFTVTERQTFQPWPERLSNNVEELLQSSLSLGGQEQAPEHKQEQGVEHRQEPTQEHKQE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACRBP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
IHC Retrieval method: HIER pH6, ICC/IF Fixation/Permeabilization: PFA/Triton X-100
Theoretical MW
61 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Monkey reactivity reported in the literature (PMID: 30358843). Use in Rhesus Macaque reported in secitific publication (PMID: 32351003).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for ACRBP Antibody - BSA Free
acrosin binding protein
acrosin-binding protein
Cancer/testis antigen 23
Cancer/testis antigen OY-TES-1
CT23FLJ51160
OY-TES-1
proacrosin binding protein sp32
Proacrosin-binding protein sp32
SP32
Background
ACRBP is encoded by this gene is similar to proacrosin binding protein sp32 precursor found in mouse, guinea pig, and pig. This protein is located in the sperm acrosome and is thought to function as a binding protein to proacrosin for packaging and condensation of the acrosin zymogen in the acrosomal matrix. This protein is a member of the cancer/testis family of antigens and it is found to be immunogenic. In normal tissues, this mRNA is expressed only in testis, whereas it is detected in a range of different tumor types such as bladder, breast, lung, liver, and colon. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our ACRBP Antibody - BSA Free and receive a gift card or discount.
![Immunohistochemistry-Paraffin: ACRBP Antibody [NBP1-85407] - Staining in human testis and endometrium tissues using anti-ACRBP antibody. Corresponding ACRBP RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ACRBP-Antibody-Immunohistochemistry-Paraffin-NBP1-85407-img0010.jpg "Immunohistochemistry-Paraffin: ACRBP Antibody [NBP1-85407] - Staining in human testis and endometrium tissues using anti-ACRBP antibody. Corresponding ACRBP RNA-seq data are presented for the same tissues.")
![Western Blot: ACRBP Antibody [NBP1-85407] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/ACRBP-Antibody-Western-Blot-NBP1-85407-img0005.jpg "Western Blot: ACRBP Antibody [NBP1-85407] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
![Immunocytochemistry/Immunofluorescence: ACRBP Antibody [NBP1-85407] - Staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/ACRBP-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85407-img0006.jpg "Immunocytochemistry/Immunofluorescence: ACRBP Antibody [NBP1-85407] - Staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: ACRBP Antibody [NBP1-85407] - Staining of human endometrium shows low expression as expected.](http://images.novusbio.com/fullsize/ACRBP-Antibody-Immunohistochemistry-Paraffin-NBP1-85407-img0007.jpg "Immunohistochemistry-Paraffin: ACRBP Antibody [NBP1-85407] - Staining of human endometrium shows low expression as expected.")
![Immunohistochemistry-Paraffin: ACRBP Antibody [NBP1-85407] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/ACRBP-Antibody-Immunohistochemistry-Paraffin-NBP1-85407-img0008.jpg "Immunohistochemistry-Paraffin: ACRBP Antibody [NBP1-85407] - Staining of human testis shows high expression.")
![Western Blot Syntaxin-BP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syntaxin-BP1_AF5675_Western_Blot_5803.jpg)
![Immunohistochemistry Syntaxin-BP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syntaxin-BP1_AF5675_Immunohistochemistry_7192.jpg)
![Knockout Validated Syntaxin-BP1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af5675_human-mouse-rat-syntaxin-bp1-affinity-purified-polyclonal-ab-knockout-validated-2410202414339.png)
![Immunocytochemistry Prohibitin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prohibitin_AF3470_Immunocytochemistry__Immunofluorescence_20123.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")