![Immunohistochemistry-Paraffin: ACRBP Antibody [NBP1-85407] - Staining in human testis and endometrium tissues using anti-ACRBP antibody. Corresponding ACRBP RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ACRBP-Antibody-Immunohistochemistry-Paraffin-NBP1-85407-img0010.jpg "Immunohistochemistry-Paraffin: ACRBP Antibody [NBP1-85407] - Staining in human testis and endometrium tissues using anti-ACRBP antibody. Corresponding ACRBP RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Pm, RMSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AKRVLCSQPVSILSPNTLKEIEASAEVSPTTMTSPISPHFTVTERQTFQPWPERLSNNVEELLQSSLSLGGQEQAPEHKQEQGVEHRQEPTQEHKQE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ACRBP |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC Retrieval method: HIER pH6, ICC/IF Fixation/Permeabilization: PFA/Triton X-100 |
||
| Theoretical MW | 61 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot Syntaxin-BP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syntaxin-BP1_AF5675_Western_Blot_5803.jpg)
![Immunohistochemistry Syntaxin-BP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syntaxin-BP1_AF5675_Immunohistochemistry_7192.jpg)
![Knockout Validated Syntaxin-BP1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af5675_human-mouse-rat-syntaxin-bp1-affinity-purified-polyclonal-ab-knockout-validated-2410202414339.png)
![Immunocytochemistry Prohibitin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prohibitin_AF3470_Immunocytochemistry__Immunofluorescence_20123.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: ACRBP Antibody [NBP1-85407] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/ACRBP-Antibody-Western-Blot-NBP1-85407-img0005.jpg "Western Blot: ACRBP Antibody [NBP1-85407] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
![Immunocytochemistry/Immunofluorescence: ACRBP Antibody [NBP1-85407] - Staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/ACRBP-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85407-img0006.jpg "Immunocytochemistry/Immunofluorescence: ACRBP Antibody [NBP1-85407] - Staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: ACRBP Antibody [NBP1-85407] - Staining of human endometrium shows low expression as expected.](http://images.novusbio.com/fullsize/ACRBP-Antibody-Immunohistochemistry-Paraffin-NBP1-85407-img0007.jpg "Immunohistochemistry-Paraffin: ACRBP Antibody [NBP1-85407] - Staining of human endometrium shows low expression as expected.")
![Immunohistochemistry-Paraffin: ACRBP Antibody [NBP1-85407] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/ACRBP-Antibody-Immunohistochemistry-Paraffin-NBP1-85407-img0008.jpg "Immunohistochemistry-Paraffin: ACRBP Antibody [NBP1-85407] - Staining of human testis shows high expression.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")