![Western Blot: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882] - Sample Type: 721_B Antibody Dilution: 1.0 ug/ml SLC33A1 is supported by BioGPS gene expression data to be expressed in 721_B](http://images.novusbio.com/fullsize/Acetyl-coenzyme-A-transporter-1-Antibody-Western-Blot-NBP1-59882-img0010.jpg "Western Blot: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882] - Sample Type: 721_B Antibody Dilution: 1.0 ug/ml SLC33A1 is supported by BioGPS gene expression data to be expressed in 721_B")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to SLC33A1(solute carrier family 33 (acetyl-CoA transporter), member 1) The peptide sequence was selected from the middle region of SLC33A1.
Peptide sequence CNSVGQTAGYFLGNVLFLALESADFCNKYLRFQPQPRGIVTLSDFLFFWG The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC33A1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Immunohistochemistry ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Immunohistochemistry_6703.jpg)
![Western Blot ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Flow_Cytometry_20028.jpg)
![Simple Western ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Simple_Western_20109.jpg)
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882] - Formalin Fixed Paraffin Embedded Tissue: Human Adult heart Observed Staining: Cytoplasmic,Membrane Primary Antibody Concentration: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec Protocol located in Reviews and Data.](http://images.novusbio.com/fullsize/Acetyl-coenzyme-A-transporter-1-Antibody-Immunohistochemistry-NBP1-59882-img0007.jpg "Immunohistochemistry: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882] - Formalin Fixed Paraffin Embedded Tissue: Human Adult heart Observed Staining: Cytoplasmic,Membrane Primary Antibody Concentration: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec Protocol located in Reviews and Data.")
![Western Blot: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882] - Human Placenta lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize/Acetyl-coenzyme-A-transporter-1-Antibody-Western-Blot-NBP1-59882-img0003.jpg "Western Blot: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882] - Human Placenta lysate, concentration 0.2-1 ug/ml.")
![Western Blot: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882] - Antibody Titration: 1 ug/ml Human heart.](http://images.novusbio.com/fullsize/Acetyl-coenzyme-A-transporter-1-Antibody-Western-Blot-NBP1-59882-img0006.jpg "Western Blot: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882] - Antibody Titration: 1 ug/ml Human heart.")
![Western Blot: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882] - Sample Type: Hela Antibody Dilution: 1.0 ug/ml SLC33A1 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells](http://images.novusbio.com/fullsize/Acetyl-coenzyme-A-transporter-1-Antibody-Western-Blot-NBP1-59882-img0008.jpg "Western Blot: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882] - Sample Type: Hela Antibody Dilution: 1.0 ug/ml SLC33A1 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells")
![Western Blot: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882] - Sample Type: Human Fetal Brain Antibody Dilution: 1.0 ug/ml](http://images.novusbio.com/fullsize/Acetyl-coenzyme-A-transporter-1-Antibody-Western-Blot-NBP1-59882-img0009.jpg "Western Blot: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882] - Sample Type: Human Fetal Brain Antibody Dilution: 1.0 ug/ml")
![Immunohistochemistry: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882] - Human Adult Small intestine Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 sec.](http://images.novusbio.com/fullsize/Acetyl-coenzyme-A-transporter-1-Antibody-Immunohistochemistry-NBP1-59882-img0005.jpg "Immunohistochemistry: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882] - Human Adult Small intestine Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 sec.")
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/Angiogenin_DAN00_ELISA_28.jpg)
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/DATA_Angiogenin_DAN00_ELISA_571.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![N/A Endothelin-1 [HRP]](https://images.novusbio.com/images2/Endothelin-1_QET00_ELISA_432.jpg)
![N/A Endothelin-1 [HRP]](https://images.novusbio.com/images2/DATA_Endothelin1_QET00_ELISA_1074.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")