![Immunohistochemistry-Paraffin: ACAT2 Antibody [NBP1-89525] - Staining in human liver and skeletal muscle tissues using NBP1-89525 antibody. Corresponding ACAT2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ACAT2-Antibody-Immunohistochemistry-Paraffin-NBP1-89525-img0021.jpg "Immunohistochemistry-Paraffin: ACAT2 Antibody [NBP1-89525] - Staining in human liver and skeletal muscle tissues using NBP1-89525 antibody. Corresponding ACAT2 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SIGIGDSSIVVAGGMENMSKAPHLAYLRTGVKIGEMPLTDSILCDGLTDAFHNCHMGITAENVAKKWQVSREDQDKVAVLS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ACAT2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Theoretical MW | 41 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-89525 | Applications | Species |
|---|---|---|
| Go GW, Srivastava R, Hernandez-Ono A et al. The Combined Hyperlipidemia Caused by Impaired Wnt-LRP6 Signaling Is Reversed by Wnt3a Rescue. Cell Metab. 2014-02-10 [PMID: 24506864] (WB, Mouse) | WB | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for ACAT2 Antibody (NBP1-89525)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: ACAT2 Antibody [NBP1-89525] - Staining of human gastrointestinal, liver, skeletal muscle and testis using Anti-ACAT2 antibody NBP1-89525 (A) shows similar protein distribution across tissues to independent antibody NBP1-89526 (B).](http://images.novusbio.com/fullsize/ACAT2-Antibody-Immunohistochemistry-Paraffin-NBP1-89525-img0016.jpg "Immunohistochemistry-Paraffin: ACAT2 Antibody [NBP1-89525] - Staining of human gastrointestinal, liver, skeletal muscle and testis using Anti-ACAT2 antibody NBP1-89525 (A) shows similar protein distribution across tissues to independent antibody NBP1-89526 (B).")
![Western Blot: ACAT2 Antibody [NBP1-89525] - Analysis using Anti-ACAT2 antibody NBP1-89525 (A) shows similar pattern to independent antibody NBP1-85967 (B).](http://images.novusbio.com/fullsize/ACAT2-Antibody-Western-Blot-NBP1-89525-img0011.jpg "Western Blot: ACAT2 Antibody [NBP1-89525] - Analysis using Anti-ACAT2 antibody NBP1-89525 (A) shows similar pattern to independent antibody NBP1-85967 (B).")
![Immunohistochemistry-Paraffin: ACAT2 Antibody [NBP1-89525] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/ACAT2-Antibody-Immunohistochemistry-Paraffin-NBP1-89525-img0017.jpg "Immunohistochemistry-Paraffin: ACAT2 Antibody [NBP1-89525] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: ACAT2 Antibody [NBP1-89525] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/ACAT2-Antibody-Immunohistochemistry-Paraffin-NBP1-89525-img0018.jpg "Immunohistochemistry-Paraffin: ACAT2 Antibody [NBP1-89525] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: ACAT2 Antibody [NBP1-89525] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/ACAT2-Antibody-Immunohistochemistry-Paraffin-NBP1-89525-img0019.jpg "Immunohistochemistry-Paraffin: ACAT2 Antibody [NBP1-89525] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: ACAT2 Antibody [NBP1-89525] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.](http://images.novusbio.com/fullsize/ACAT2-Antibody-Immunohistochemistry-Paraffin-NBP1-89525-img0020.jpg "Immunohistochemistry-Paraffin: ACAT2 Antibody [NBP1-89525] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.")
![Immunohistochemistry LDLR Antibody [Unconjugated]](https://images.novusbio.com/images2/LDL_R_AF2255_Immunohistochemistry_7149.jpg)
![Western Blot LDLR Antibody [Unconjugated]](https://images.novusbio.com/images2/LDLR_AF2255_Western_Blot_23731.jpg)
![Western Blot LDLR Antibody [Unconjugated]](https://images.novusbio.com/images/af2255_mouse-ldl-r-affinity-purified-polyclonal-ab-4120241049445.jpg)
![Immunohistochemistry Apolipoprotein B/ApoB Antibody (369717) [Unconjugated]](https://images.novusbio.com/images2/Apolipoprotein_B_MAB4124_Immunohistochemistry_22141.jpg)
![Western Blot Apolipoprotein B/ApoB Antibody (369717) [Unconjugated]](https://images.novusbio.com/images2/Apolipoprotein_B_MAB4124_Western_Blot_20437.jpg)
![Simple Western Apolipoprotein B/ApoB Antibody (369717) [Unconjugated]](https://images.novusbio.com/images/antibody/mab4124_human-apolipoprotein-b-apob-mab-clone-369717-simple-western-301202492438..jpg)
![Immunocytochemistry CYP7A1 Antibody (946902) [Unconjugated]](https://images.novusbio.com/images2/CYP7A1_MAB9120_Immunocytochemistry__Immunofluorescence_19938.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")