| Reactivity | HuSpecies Glossary |
| Applications | AC |
| Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human 53BP1 Source: E. coli Amino Acid Sequence: AYQCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGYSLEEQRILDWQPRENPFQNLKVLLVSDQQQNFLELWSEILMTGGAASVKQHHSSAHNKDIALGVFDVVVTDPSCPASVLKCAEAL Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source | E. coli |
| Protein/Peptide Type | Recombinant Protein Antigen |
| Gene | TP53BP1 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Application Notes | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54659. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW | 33 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for 53BP1 Recombinant Protein Antigen (NBP2-54659PEP)Find related products by research area.
|
|
The recent relationship of BRCA1 and 53BP1 The p53-binding protein 1 (53BP1) is a DNA damage response factor, which is recruited to nuclear structures at the site of DNA damage. DNA double-strand breaks (DSBs) are mutations that are detrimental to cell viability and genome stability, and m... Read full blog post. |
|
53BP1 - a marker for DNA Double Strand Break 53BP1 (p53 binding protein 1) was originally thought to be an enhancer for p53 transcriptional, but later studies have demonstrated that it is actually a substrate for ataxia telangiectasia mutated (ATM). 53BP1 is a classic late DNA damage response... Read full blog post. |
|
53BP1 - DNA damage is no fun The 53BP1 (p53 binding protein 1) was initially believed to be a p53 transcriptional enhancing partner, but it has now been established as an ataxia telangiectasia mutated (ATM) substrate. As a late DNA damage response (DDR) marker, 53BP1 appears duri... Read full blog post. |
|
53BP1, DNA Damage Response and Tumor Suppression 53BP1 (p53 binding protein 1) was originally thought to be a p53 transcriptional enhancing partner, but now has been shown to be an ataxia telangiectasia mutated (ATM) substrate. It is a late DNA damage response (DDR) marker, appearing in the telophas... Read full blog post. |
|
53BP1, DNA Damage Response and Tumor Suppression 53BP1 (p53 binding protein 1) was originally thought to be a p53 transcriptional enhancing partner, but now has been shown to be an ataxia telangiectasia mutated (ATM) substrate. It is a late DNA damage response (DDR) marker, appearing in the telophas... Read full blog post. |
|
NUP153 & 53BP1: A Novel DNA Repair Pathway Mediating DNA damage is a crucial process, and one of the most important cellular guards against cancer. In response to DNA damage, sophisticated cellular machinery is recruited to repair the breaks, and if it fails, the cell is committed to death. De... Read full blog post. |
|
Blocking 53BP1 Expression Lessens Tumor Development in BRCA1-Defective Mice Our antibody database at Novus Biologicals provides research tools for the forefront of cancer research. Recently, a mouse study using 53BP1 and BRCA1 antibodies showed that deletion of 53BP1 greatly lessened the incidence of tumor development in mice... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TP53BP1 |
![Western Blot Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/Histone_H2AX_AF2288_Western_Blot_5182.jpg)
![Simple Western Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/16395.jpg)
![Immunocytochemistry Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/Histone_H2AX_AF2288_Immunocytochemistry__Immunofluorescence_16920.jpg)
![Western Blot Chk2 [p Thr68] Antibody [Unconjugated]](https://images.novusbio.com/images2/Chk2_AF1626_Western_Blot_5130.jpg)
![Immunocytochemistry Chk2 [p Thr68] Antibody [Unconjugated]](https://images.novusbio.com/images2/Chk2_AF1626_Immunocytochemistry__Immunofluorescence_18847.jpg)
![Western Blot DDR1 Antibody [Unconjugated]](https://images.novusbio.com/images2/DDR1_AF2396_Western_Blot_16723.jpg)
![Simple Western DDR1 Antibody [Unconjugated]](https://images.novusbio.com/images2/DDR1_AF2396_Immunohistochemistry_17635.jpg)
![Immunohistochemistry DDR1 Antibody [Unconjugated]](https://images.novusbio.com/images2/DDR1_AF2396_Immunohistochemistry_7152.jpg)
