14-3-3 zeta Antibody - BSA Free Summary
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 146-245 of human 14-3-3 zeta (NP_001129171.1). QQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
YWHAZ |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS with 50% glycerol, pH7.3. |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for 14-3-3 zeta Antibody - BSA Free
Background
14-3-3 zeta is a protein that mediates signal transduction by binding to phosphoserine-containing proteins. The protein is widely expressed in various gray matter regions of the brain. Overexpression of the 14-3-3 zeta gene has been found to correlate with chemoresistance to anthracyclines and metastatis recurrence of human breast cancer. These effects are likely caused by an anti-apoptotic mechanism of 14-3-3 zeta during anthracycline treatment.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, KD, Simple Western, WB
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, WB
Publications for 14-3-3 zeta Antibody (NBP2-92614) (0)
There are no publications for 14-3-3 zeta Antibody (NBP2-92614).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for 14-3-3 zeta Antibody (NBP2-92614) (0)
There are no reviews for 14-3-3 zeta Antibody (NBP2-92614).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for 14-3-3 zeta Antibody (NBP2-92614) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional 14-3-3 zeta Products
Research Areas for 14-3-3 zeta Antibody (NBP2-92614)
Find related products by research area.
|
Blogs on 14-3-3 zeta