Orthogonal Strategies: Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Analysis in human prostate and skeletal muscle tissues using NBP1-87416 antibody. Corresponding SORD RNA-seq ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human kidney, liver, prostate and skeletal muscle using Anti-SORD antibody NBP1-87416 (A) shows ...read more
Independent Antibodies: Western Blot: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Analysis using Anti-SORD antibody NBP1-87416 (A) shows similar pattern to independent antibody NBP1-87415 (B).
Immunocytochemistry/ Immunofluorescence: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
This antibody was developed against Recombinant Protein corresponding to amino acids: LLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SORD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
IHC, WB reported in scientific literature (PMID: 24567419). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (85%). Human reactivity reported in scientific literature (PMID: 24567419).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for Sorbitol Dehydrogenase Antibody
EC 1.1.1
EC 1.1.1.14
L-iditol 2-dehydrogenase
sorbitol dehydrogenase
SORD1
Background
Sorbitol dehydrogenase (SDH), a member of the medium-chain dehydrogenase/reductase protein family and the second enzyme of the polyol pathway of glucose metabolism, converts sorbitol to fructose strictly using NAD(+) as coenzyme. SDH is expressed almost ubiquitously in all mammalian tissues. The enzyme has attracted considerable interest due to its implication in the development of diabetic complications as the polyol pathway is particularly active in hyperglycemic states. Although SORD is closely related to the class I long-chain alcohol dehydrogenases, it differs in substrate specificity, catalyzing polyols such as sorbitol and xylitol but having no activity towards primary alcohols.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for Sorbitol Dehydrogenase Antibody (NBP1-87416) (0)
There are no reviews for Sorbitol Dehydrogenase Antibody (NBP1-87416).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Sorbitol Dehydrogenase Antibody and receive a gift card or discount.