Home » ZFX » ZFX Antibodies » ZFX Antibody
Novus Biologicals products are now on bio-techne.com

ZFX Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: ZFX Antibody [NBP2-86421] - Host: Rabbit. Target Name: ZFX. Sample Tissue: Human 293T. Antibody Dilution: 1.0ug/ml
Western Blot: ZFX Antibody [NBP2-86421] - Host: Rabbit. Target Name: ZFX. Sample Tissue: Human 293T. Antibody Dilution: 1.0ug/ml
Immunohistochemistry-Paraffin: ZFX Antibody [NBP2-86421] - Rabbit Anti-ZFX Antibody. Paraffin Embedded Tissue: Human alveolar cell. Cellular Data: Epithelial cells of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml. ...read more
Immunohistochemistry-Paraffin: ZFX Antibody [NBP2-86421] - Human Small Intestine: Formalin-Fixed, Paraffin-Embedded (FFPE).. Antibody Concentration: 10 ug/ml.
Immunohistochemistry-Paraffin: ZFX Antibody [NBP2-86421] - Human Skin: Formalin-Fixed, Paraffin-Embedded (FFPE).. Antibody Concentration: 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ZFX Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZFX. Peptide sequence: KVYIFKADPGEDDLGGTVDIVESEPENDHGVELLDQNSSIRVPREKMVYM The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ZFX
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for ZFX Antibody

  • zinc finger protein, X-linked

Background

ZFX, also known as Zinc finger X-chromosomal protein, is a 91kDa 805 amino acid protein with a shorter 66kDa 576 isoform. The gene can be found in the nucleus where it encodes a member of the krueppel C2H2-type zinc-finger protein family. Current research is being conducted on ZFX in relation to the diseases azoospermia, prostate adenocarcinoma, premature ovarian failure and adenocarcinoma. ZFX is linked to the dosage compensation, sex determination, spermatogenesis, meiosis, cell cycle and fertilization.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ZFY Antibody
NBP2-57923
Immunocytochemistry/ Immunofluorescence ZFY Antibody
Species: Hu
Applications: ICC/IF
SRY Antibody (1G4)
- BSA Free
NBP2-37463
ELISA SRY Antibody (1G4) - BSA Free
Western Blot SRY Antibody (1G4) - BSA Free
Western Blot SRY Antibody (1G4) - BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Steroid sulfatase
Antibody
NBP1-90095
Immunohistochemistry-Paraffin Steroid sulfatase Antibody
Immunohistochemistry-Paraffin Steroid sulfatase Antibody
Immunohistochemistry-Paraffin Steroid sulfatase Antibody
(3 Publications)
Species: Hu
Applications: IHC, IHC-P
Glucose 6
Phosphate Dehydrogena ...
NB100-236
Immunoprecipitation Glucose 6 Phosphate Dehydrogenase Antibody
Western Blot Glucose 6 Phosphate Dehydrogenase Antibody
Western Blot Glucose 6 Phosphate Dehydrogenase Antibody
(19 Publications)
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, IP, WB
RPS4X Antibody
NBP3-21449
Immunohistochemistry-Paraffin RPS4X Antibody
Immunohistochemistry-Paraffin RPS4X Antibody
Immunohistochemistry-Paraffin RPS4X Antibody
Species: Hu
Applications: IHC-P
DNA polymerase
alpha Antibody
NBP1-47256
Immunocytochemistry/ Immunofluorescence DNA polymerase alpha Antibody
Western Blot DNA polymerase alpha Antibody
(1 Review)
Species: Hu, Mu
Applications: ICC/IF, IP, WB
Oct-3/4 Antibody
[Unconjugated]
AF1759
Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]
Immunocytochemistry Oct-3/4 Antibody [Unconjugated]
Simple Western Oct-3/4 Antibody [Unconjugated]
(77 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
HPRT Antibody
NBP1-33527
Western Blot HPRT Antibody
Western Blot HPRT Antibody
Immunohistochemistry-Paraffin HPRT Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Western Blot c-Myc Antibody (9E10) - BSA Free
(4 Reviews)
(46 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
UBL4A Antibody
(OTI1D4)
NBP2-03621
Western Blot UBL4A Antibody (OTI1D4)
Immunohistochemistry-Paraffin UBL4A Antibody (OTI1D4)
Immunocytochemistry/ Immunofluorescence UBL4A Antibody (OTI1D4)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
SMCX Antibody
NB100-55328
Western Blot SMCX Antibody
(3 Publications)
Species: Hu
Applications: IP, WB
Dystrophin Antibody
NBP1-89953
Immunohistochemistry-Paraffin Dystrophin Antibody
Immunohistochemistry-Paraffin Dystrophin Antibody
Immunohistochemistry-Paraffin Dystrophin Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NANOGP8 Antibody
H00388112-B01P
Western Blot NANOGP8 Antibody
Species: Hu
Applications: WB
Nanog Antibody
[Unconjugated]
AF1997
Chromatin Immunoprecipitation (ChIP) Nanog Antibody [Unconjugated]
Immunocytochemistry Nanog Antibody [Unconjugated]
Immunocytochemistry Nanog Antibody [Unconjugated]
(5 Reviews)
(309 Publications)
Species: Hu
Applications: ChIP, ICC, IHC, Simple Western, WB
SOX2 Antibody
[Unconjugated]
AF2018
Western Blot SOX2 Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) SOX2 Antibody [Unconjugated]
Simple Western SOX2 Antibody [Unconjugated]
(6 Reviews)
(369 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
Steroid sulfatase
Antibody
NBP1-90095
Immunohistochemistry-Paraffin Steroid sulfatase Antibody
Immunohistochemistry-Paraffin Steroid sulfatase Antibody
Immunohistochemistry-Paraffin Steroid sulfatase Antibody
(3 Publications)
Species: Hu
Applications: IHC, IHC-P

Publications for ZFX Antibody (NBP2-86421) (0)

There are no publications for ZFX Antibody (NBP2-86421).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZFX Antibody (NBP2-86421) (0)

There are no reviews for ZFX Antibody (NBP2-86421). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZFX Antibody (NBP2-86421) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZFX Products

Research Areas for ZFX Antibody (NBP2-86421)

Find related products by research area.

Blogs on ZFX

There are no specific blogs for ZFX, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZFX Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ZFX