Home » WDR5 » WDR5 Proteins » WDR5 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

WDR5 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for WDR5 Recombinant Protein Antigen (NBP2-55518PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

WDR5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human WDR5.

Source: E. coli

Amino Acid Sequence: ATEEKKPETEAARAQPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
WDR5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55518.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for WDR5 Recombinant Protein Antigen

  • BIG3
  • BIG-3
  • BMP2-induced 3-kb gene protein
  • SWD3
  • SWD3, Set1c WD40 repeat protein, homolog
  • WD repeat domain 5
  • WD repeat-containing protein 5
  • WDR5
  • WD-repeat protein 5

Background

WDR5 encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 7 WD repeats. Alternatively spliced transcript variants encoding the same protein have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Histone H3
Antibody - BSA Free
NB500-171
Immunohistochemistry-Paraffin Histone H3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Histone H3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Histone H3 Antibody - BSA Free
(8 Reviews)
(28 Publications)
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
ASH2L Antibody
NB600-250
Western Blot ASH2L Antibody
Western Blot ASH2L Antibody
Immunohistochemistry-Paraffin ASH2L Antibody
(13 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, WB
RbBP5 Antibody
NB600-252
Chromatin Immunoprecipitation Sequencing RbBP5 Antibody
Western Blot RbBP5 Antibody
Western Blot RbBP5 Antibody
(1 Review)
(13 Publications)
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, ICC/IF, IHC, IHC-P, IP, WB
SETD1A Antibody
NB100-558
Immunoprecipitation SETD1A Antibody
Western Blot SETD1A Antibody
Immunohistochemistry-Paraffin SETD1A Antibody
(5 Publications)
Species: Hu
Applications: ChIP, CHIP-SEQ, IHC, IHC-P, IP, WB
Host Cell Factor
1/HCFC1 Antibody
NB100-68210
Simple Western Host Cell Factor 1/HCFC1 Antibody
Western Blot Host Cell Factor 1/HCFC1 Antibody
Western Blot Host Cell Factor 1/HCFC1 Antibody
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: IP, Simple Western, WB
KMT2B Antibody
NB300-864
Immunohistochemistry-Paraffin KMT2B Antibody
Immunohistochemistry-Paraffin KMT2B Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
KMT2D Antibody
NBP1-89123
Immunohistochemistry-Paraffin KMT2D Antibody
Immunohistochemistry-Paraffin KMT2D Antibody
Immunohistochemistry-Paraffin KMT2D Antibody
(4 Publications)
Species: Hu
Applications: IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(803 Publications)
Species: Hu
Applications: BA
MYST1 Antibody
NB100-55251
Immunohistochemistry-Paraffin MYST1 Antibody
Western Blot MYST1 Antibody
Western Blot MYST1 Antibody
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Osteopontin/OPN
Antibody [Unconjugate
AF808
Immunocytochemistry Osteopontin/OPN Antibody [Unconjugated]
Neutralization Osteopontin/OPN Antibody [Unconjugated]
Immunohistochemistry Osteopontin/OPN Antibody [Unconjugated]
(2 Reviews)
(203 Publications)
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
ASCL2/Mash2
Antibody [Unconjugate
AF6539
Western Blot ASCL2/Mash2 Antibody [Unconjugated]
Immunohistochemistry ASCL2/Mash2 Antibody [Unconjugated]
(3 Publications)
Species: Hu
Applications: IHC, WB
HIST1H4F
Overexpression Lysate
NBP2-07996
Western Blot HIST1H4F Overexpression Lysate
Species: Hu
Applications: WB
H4/n Antibody
(3E7H2) - BSA Free
NBP2-52486
ELISA H4/n Antibody (3E7H2) - BSA Free
Western Blot H4/n Antibody (3E7H2) - BSA Free
Flow Cytometry H4/n Antibody (3E7H2) - BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
RUNX2/CBFA1
Antibody (232902) [Un ...
MAB2006
Immunocytochemistry RUNX2/CBFA1 Antibody (232902) [Unconjugated]
(1 Review)
(28 Publications)
Species: Hu
Applications: ICC
Cytokeratin 4
Antibody (SN74-03)
NBP2-67706
Flow Cytometry Cytokeratin 4 Antibody (SN74-03)
Immunocytochemistry/ Immunofluorescence Cytokeratin 4 Antibody (SN74-03)
Immunocytochemistry/ Immunofluorescence Cytokeratin 4 Antibody (SN74-03)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Oct-3/4 Antibody
[Unconjugated]
AF1759
Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]
Immunocytochemistry Oct-3/4 Antibody [Unconjugated]
Simple Western Oct-3/4 Antibody [Unconjugated]
(73 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Histamine
N-Methyltransferase/H ...
NBP1-89495
Western Blot Histamine N-Methyltransferase/HNMT Antibody
Immunohistochemistry-Paraffin Histamine N-Methyltransferase/HNMT Antibody
Immunohistochemistry-Paraffin Histamine N-Methyltransferase/HNMT Antibody
Species: Hu
Applications: IHC, IHC-P, WB
PITX2 Antibody
[Unconjugated]
AF7388
Immunohistochemistry PITX2 Antibody [Unconjugated]
(8 Publications)
Species: Hu
Applications: IHC

Publications for WDR5 Recombinant Protein Antigen (NBP2-55518PEP) (0)

There are no publications for WDR5 Recombinant Protein Antigen (NBP2-55518PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR5 Recombinant Protein Antigen (NBP2-55518PEP) (0)

There are no reviews for WDR5 Recombinant Protein Antigen (NBP2-55518PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for WDR5 Recombinant Protein Antigen (NBP2-55518PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional WDR5 Products

Research Areas for WDR5 Recombinant Protein Antigen (NBP2-55518PEP)

Find related products by research area.

Blogs on WDR5

There are no specific blogs for WDR5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Osteopontin/OPN was detected in immersion fixed C2C12 mouse myoblast cell line (left panel, positive stain) and mouse splenocytes (right panel, negative stain) using Goat Anti-Mouse Osteopontin/OPN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF808) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and secreted molecule. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Osteopontin/OPN Antibody [Unconjugated]
AF808

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our WDR5 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol WDR5