Home » UFD1L » UFD1L Proteins » UFD1L Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

UFD1L Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for UFD1L Protein (NBP1-86879PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

UFD1L Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UFD1L.

Source: E. coli

Amino Acid Sequence: QVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDAPLG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
UFD1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86879.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for UFD1L Recombinant Protein Antigen

  • ATP1C
  • ATP1G1ATPase, Na+/K+ transporting, gamma 1 polypeptide
  • FXYD domain containing ion transport regulator 2
  • FXYD domain-containing ion transport regulator 2
  • HOMG2
  • hypomagnesemia 2, renal
  • MGC12372
  • Na(+)/K(+) ATPase subunit gamma
  • Sodium pump gamma chain
  • sodium/potassium-transporting ATPase subunit gamma
  • Sodium-potassium-ATPase, gamma polypeptide

Background

The protein encoded by the UFD1L gene forms a complex with two other proteins, nuclear protein localization-4 and valosin-containing protein, and this complex is necessary for the degradation of ubiquitinated proteins. In addition, this complex controls the disassembly of the mitotic spindle and the formation of a closed nuclear envelope after mitosis. Mutations in this gene have been associated with Catch 22 syndrome as well as cardiac and craniofacial defects. Alternative splicing results in multiple transcript variants encoding different isoforms. A related pseudogene has been identified on chromosome 18. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

p97/VCP Antibody
NB100-1558
Western Blot p97/VCP Antibody
Western Blot p97/VCP Antibody
Western Blot p97/VCP Antibody
(12 Publications)
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
NPLOC4 Antibody
NBP1-82166
Western Blot NPLOC4 Antibody
Western Blot NPLOC4 Antibody
Immunohistochemistry-Paraffin NPLOC4 Antibody
(1 Review)
(8 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Gemin 4 Antibody
NB110-40591
Western Blot Gemin 4 Antibody
Immunohistochemistry-Paraffin Gemin 4 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Craniofacial
Development Protein 1 ...
NBP2-43772
Immunohistochemistry-Paraffin Craniofacial Development Protein 1 Antibody (11811)
Immunohistochemistry-Paraffin Craniofacial Development Protein 1 Antibody (11811)
Immunocytochemistry/ Immunofluorescence Craniofacial Development Protein 1 Antibody (11811)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Proteasome 19S 10B
Antibody
NB100-1483
Western Blot Proteasome 19S 10B Antibody
Immunocytochemistry/ Immunofluorescence Proteasome 19S 10B Antibody
Flow Cytometry Proteasome 19S 10B Antibody
(6 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, PEP-ELISA, PLA, WB
DAP5 Antibody
NBP1-85311
Western Blot DAP5 Antibody
Western Blot DAP5 Antibody
Immunohistochemistry-Paraffin DAP5 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NSFL1C Antibody
NBP2-13677
Immunocytochemistry/ Immunofluorescence NSFL1C Antibody
Immunohistochemistry-Paraffin NSFL1C Antibody
Immunohistochemistry-Paraffin NSFL1C Antibody
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ING1 Antibody
AF5758
Western Blot ING1 Antibody
Immunocytochemistry ING1 Antibody
Immunohistochemistry ING1 Antibody
Species: Hu
Applications: ICC, IHC, WB
SCGF/CLEC11a
Antibody (239029) [Un ...
MAB1904
Immunocytochemistry SCGF/CLEC11a Antibody (239029) [Unconjugated]
Immunohistochemistry SCGF/CLEC11a Antibody (239029) [Unconjugated]
Immunohistochemistry SCGF/CLEC11a Antibody (239029) [Unconjugated]
(4 Publications)
Species: Hu
Applications: ICC, IHC, WB
AKAP13 Antibody
NBP1-89163
Immunocytochemistry/ Immunofluorescence AKAP13 Antibody
Immunohistochemistry-Paraffin AKAP13 Antibody
Immunohistochemistry-Paraffin AKAP13 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Pleckstrin Antibody
NB100-1343
Immunohistochemistry-Paraffin Pleckstrin Antibody
Immunohistochemistry-Paraffin Pleckstrin Antibody
Western Blot Pleckstrin Antibody
(2 Publications)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
p97/VCP Antibody
NB100-1558
Western Blot p97/VCP Antibody
Western Blot p97/VCP Antibody
Western Blot p97/VCP Antibody
(12 Publications)
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
TBX1 Antibody
(OTI1C2)
NBP2-46076
Western Blot TBX1 Antibody (OTI1C2)
Immunohistochemistry-Paraffin TBX1 Antibody (OTI1C2)
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
CDC45L Antibody
NBP1-85723
Western Blot CDC45L Antibody
Immunohistochemistry-Paraffin CDC45L Antibody
Immunohistochemistry-Paraffin CDC45L Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CFTR Antibody
(24-1) [Unconjugated] ...
MAB25031
Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus
Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus
Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus
(10 Reviews)
(76 Publications)
Species: Hu
Applications: IHC, IP, WB
HAND2 Antibody
[Unconjugated]
AF3876
Immunohistochemistry HAND2 Antibody [Unconjugated]
(5 Publications)
Species: Hu, Mu
Applications: IHC, WB
HRD1 Antibody -
BSA Free
NB100-2526
Immunohistochemistry-Paraffin HRD1 Antibody - BSA Free
Western Blot HRD1 Antibody - BSA Free
Western Blot HRD1 Antibody - BSA Free
(3 Reviews)
(15 Publications)
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
UFD1L Recombinant
Protein Antigen
NBP1-86879PEP
UFD1L Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for UFD1L Protein (NBP1-86879PEP) (0)

There are no publications for UFD1L Protein (NBP1-86879PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UFD1L Protein (NBP1-86879PEP) (0)

There are no reviews for UFD1L Protein (NBP1-86879PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for UFD1L Protein (NBP1-86879PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UFD1L Products

Blogs on UFD1L

There are no specific blogs for UFD1L, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

CFTR was detected in immersion fixed paraffin-embedded sections of human placenta using 8 µg/mL Mouse Anti-Human CFTR C-Terminus Monoclonal Antibody (Catalog # MAB25031) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-AEC Cell & Tissue Staining Kit (red; Catalog # CTS003) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
CFTR Antibody (24-1) [Unconjugated] - C-terminus
MAB25031
Immunohistochemistry-Paraffin: HRD1 Antibody [NB100-2526] - FFPE tissue section of human tonsil using rabbit polyclonal HRD1 antibody at 2 ug/mL concentration (1:500 dilution). The primary antibody binding to SYVN1/HRD1 antigen in cells was detected using HRP conjugated anti-Rabbit secondary antibody with DAB reagent, and the sections were further counterstained with hematoxylin for labeling cellular nuclei. This HRD1 antibody generated an expected cytoplasmic staining of HRD1 with stronger signal around periphery of the nucleus signifying the staining of the endoplasmic reticulum.
HRD1 Antibody - BSA Free
NB100-2526

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our UFD1L Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol UFD1