![Western Blot: TUFM Antibody (CL2245) [NBP2-36753] - Lane 1: Marker [kDa]. Lane 2: Human cell line U-251 MG](http://images.novusbio.com/fullsize/TUFM-Antibody-CL2245-Western-Blot-NBP2-36753-img0005.jpg "Western Blot: TUFM Antibody (CL2245) [NBP2-36753] - Lane 1: Marker [kDa]. Lane 2: Human cell line U-251 MG")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clone | CL2245 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:AVDTYIPVPARDLEKPFLLPVEAVYSVPGRGTVVTGTLERGILKKGDECELLGHSKNIRTVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMVKPGSI |
| Epitope | PFLLPVEAVYSVPGR |
| Predicted Species | Mouse (95%), Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | TUFM |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: TUFM Antibody (CL2245) [NBP2-36753] - Staining in U251 cell line showing distinct mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/TUFM-Antibody-CL2245-Immunocytochemistry-Immunofluorescence-NBP2-36753-img0010.jpg "Immunocytochemistry/Immunofluorescence: TUFM Antibody (CL2245) [NBP2-36753] - Staining in U251 cell line showing distinct mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: TUFM Antibody (CL2245) [NBP2-36753] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular epithelium cells.](http://images.novusbio.com/fullsize/TUFM-Antibody-CL2245-Immunohistochemistry-NBP2-36753-img0004.jpg "Immunohistochemistry-Paraffin: TUFM Antibody (CL2245) [NBP2-36753] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular epithelium cells.")
![Immunocytochemistry/Immunofluorescence: TUFM Antibody (CL2245) [NBP2-36753] - Staining in HeLa cell line showing distinct mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/TUFM-Antibody-CL2245-Immunocytochemistry-Immunofluorescence-NBP2-36753-img0006.jpg "Immunocytochemistry/Immunofluorescence: TUFM Antibody (CL2245) [NBP2-36753] - Staining in HeLa cell line showing distinct mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.")
![Immunocytochemistry/Immunofluorescence: TUFM Antibody (CL2245) [NBP2-36753] - Staining of human cell line A431 showing distinct mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/TUFM-Antibody-CL2245-Immunocytochemistry-Immunofluorescence-NBP2-36753-img0007.jpg "Immunocytochemistry/Immunofluorescence: TUFM Antibody (CL2245) [NBP2-36753] - Staining of human cell line A431 showing distinct mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.")
![Immunocytochemistry/Immunofluorescence: TUFM Antibody (CL2245) [NBP2-36753] - Staining in MCF7 cell line with Anti-TUFM monoclonal antibody, showing distinct mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/TUFM-Antibody-CL2245-Immunocytochemistry-Immunofluorescence-NBP2-36753-img0008.jpg "Immunocytochemistry/Immunofluorescence: TUFM Antibody (CL2245) [NBP2-36753] - Staining in MCF7 cell line with Anti-TUFM monoclonal antibody, showing distinct mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.")
![Immunocytochemistry/Immunofluorescence: TUFM Antibody (CL2245) [NBP2-36753] - Staining in U2OS cell line with Anti-TUFM monoclonal antibody, showing distinct mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/TUFM-Antibody-CL2245-Immunocytochemistry-Immunofluorescence-NBP2-36753-img0009.jpg "Immunocytochemistry/Immunofluorescence: TUFM Antibody (CL2245) [NBP2-36753] - Staining in U2OS cell line with Anti-TUFM monoclonal antibody, showing distinct mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: TUFM Antibody (CL2245) [NBP2-36753] - Staining of human skin shows granular cytoplasmic immunoreactivity in epithelial cells.](http://images.novusbio.com/fullsize/TUFM-Antibody-CL2245-Immunohistochemistry-NBP2-36753-img0001.jpg "Immunohistochemistry-Paraffin: TUFM Antibody (CL2245) [NBP2-36753] - Staining of human skin shows granular cytoplasmic immunoreactivity in epithelial cells.")
![Immunohistochemistry-Paraffin: TUFM Antibody (CL2245) [NBP2-36753] - Staining of human placenta shows strong cytoplasmic positivity in trophoblast.](http://images.novusbio.com/fullsize/TUFM-Antibody-CL2245-Immunohistochemistry-NBP2-36753-img0002.jpg "Immunohistochemistry-Paraffin: TUFM Antibody (CL2245) [NBP2-36753] - Staining of human placenta shows strong cytoplasmic positivity in trophoblast.")
![Immunohistochemistry-Paraffin: TUFM Antibody (CL2245) [NBP2-36753] - Staining of human kidney shows granular cytoplasmic immunoreactivity in renal tubules.](http://images.novusbio.com/fullsize/TUFM-Antibody-CL2245-Immunohistochemistry-NBP2-36753-img0003.jpg "Immunohistochemistry-Paraffin: TUFM Antibody (CL2245) [NBP2-36753] - Staining of human kidney shows granular cytoplasmic immunoreactivity in renal tubules.")
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")