Home » TTC12 » TTC12 Proteins » TTC12 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

TTC12 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for TTC12 Protein (NBP1-83693PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

TTC12 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TTC12.

Source: E. coli

Amino Acid Sequence: NLLETLSKPDQIPLFYAGGIEILTEMINECTEQTLFRMHNGFSIISDNEVIRRCFSTAGNDAVEEMVCVSVLKLWQAVCSRNEENQRVL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TTC12
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83693.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TTC12 Recombinant Protein Antigen

  • FLJ13859
  • FLJ20535
  • tetratricopeptide repeat domain 12
  • tetratricopeptide repeat protein 12 variant 1
  • tetratricopeptide repeat protein 12 variant 2
  • TPARMtetratricopeptide repeat protein 12
  • TPR repeat protein 12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ANKK1 Antibody
NBP1-28459
Western Blot ANKK1 Antibody
Immunohistochemistry-Paraffin ANKK1 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NCAM-1/CD56
Antibody [Unconjugate
AF2408
Western Blot NCAM-1/CD56 Antibody [Unconjugated]
Simple Western NCAM-1/CD56 Antibody [Unconjugated]
Immunocytochemistry NCAM-1/CD56 Antibody [Unconjugated]
(24 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
Dopamine D2R/DRD2
Antibody (HL1478) - A ...
NBP3-25443
Western Blot Dopamine D2R/DRD2 Antibody (HL1478) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence Dopamine D2R/DRD2 Antibody (HL1478) - Azide and BSA Free
Immunohistochemistry-Paraffin Dopamine D2R/DRD2 Antibody (HL1478) - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: Func, ICC/IF, IHC, IHC-P, WB
Ccd1/DIXDC1
Antibody [Unconjugate
AF5599
Western Blot Ccd1/DIXDC1 Antibody [Unconjugated]
Immunohistochemistry Ccd1/DIXDC1 Antibody [Unconjugated]
(1 Publication)
Species: Mu
Applications: IHC, WB
CHES1 Antibody
NBP2-38866
Immunohistochemistry-Paraffin CHES1 Antibody
Immunocytochemistry/ Immunofluorescence CHES1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MFRP Antibody
AF3445
MFRP Antibody
(3 Publications)
Species: Mu
Applications: IHC, WB
ARHGAP20 Antibody
NBP2-24757
Western Blot ARHGAP20 Antibody
Immunohistochemistry-Paraffin ARHGAP20 Antibody
Species: Hu, Pm
Applications: IHC, IHC-P, WB
RNF26 Antibody
NBP1-81150
Immunocytochemistry/ Immunofluorescence RNF26 Antibody
Immunohistochemistry-Paraffin RNF26 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
FOXN2 Antibody
NBP1-83153
Immunocytochemistry/ Immunofluorescence FOXN2 Antibody
Immunohistochemistry-Paraffin FOXN2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
SNF1LK2/SIK2
Antibody
NB100-56458
Western Blot SNF1LK2/SIK2 Antibody
(1 Publication)
Species: Bv, Ca, Hu, Mu, Pm, Rt
Applications: WB

IGSF4A/SynCAM1/CADM1 A
NB300-186
Simple Western IGSF4A/SynCAM1/CADM1 Antibody
Western Blot IGSF4A/SynCAM1/CADM1 Antibody
Immunocytochemistry/ Immunofluorescence IGSF4A/SynCAM1/CADM1 Antibody
(1 Publication)
Species: Hu, Rt
Applications: ICC/IF, Simple Western, WB
TSG Antibody
[Unconjugated]
AF756
Immunohistochemistry TSG Antibody [Unconjugated]
Immunohistochemistry TSG Antibody [Unconjugated]
(1 Publication)
Species: Mu
Applications: IHC, WB
beta-Catenin
Antibody [Unconjugate
AF1329
Western Blot beta-Catenin Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]
Simple Western beta-Catenin Antibody [Unconjugated]
(2 Reviews)
(33 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
SMAP1 Antibody
NBP1-83702
Immunohistochemistry-Paraffin SMAP1 Antibody
Western Blot SMAP1 Antibody
Western Blot SMAP1 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
BTG4 Antibody (1A6)
H00054766-M07
Western Blot BTG4 Antibody (1A6)
Immunocytochemistry/ Immunofluorescence BTG4 Antibody (1A6)
Species: Hu
Applications: ELISA, ICC/IF, WB
DSCAM-L1 Antibody
[Unconjugated]
AF3315
Flow Cytometry DSCAM-L1 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, WB
DIO2 Antibody
NBP1-00178
Flow Cytometry DIO2 Antibody
Immunocytochemistry/ Immunofluorescence DIO2 Antibody
Immunohistochemistry-Frozen DIO2 Antibody
(8 Publications)
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
FOXN4 Antibody
NBP3-09250
Western Blot FOXN4 Antibody
Species: Hu
Applications: WB

Publications for TTC12 Protein (NBP1-83693PEP) (0)

There are no publications for TTC12 Protein (NBP1-83693PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTC12 Protein (NBP1-83693PEP) (0)

There are no reviews for TTC12 Protein (NBP1-83693PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TTC12 Protein (NBP1-83693PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TTC12 Products

Blogs on TTC12

There are no specific blogs for TTC12, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TTC12 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol TTC12