![Western Blot: FOXN4 Antibody [NBP3-09250] - Western blot analysis using NBP3-09250 on Human HeLa as a positive control. Antibody Titration: 0.2-1 ug/ml](http://images.novusbio.com/fullsize/FOXN4-Antibody-Western-Blot-NBP3-09250-img0001.jpg "Western Blot: FOXN4 Antibody [NBP3-09250] - Western blot analysis using NBP3-09250 on Human HeLa as a positive control. Antibody Titration: 0.2-1 ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human FOXN4 (NP_998761). Peptide sequence HHQVQPQAHLAPDSPAPAQTPPLHALPDLSPSPLPHPAMGRAPVDFINIS |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FOXN4 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 56 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Immunohistochemistry FoxN1 Antibody (717008) [Unconjugated]](https://images.novusbio.com/images2/FoxN1_MAB7295_Immunohistochemistry_11873.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FOXN4 |
![Immunohistochemistry ASCL1/Mash1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2567_mouse-ascl1-mash1-affinity-purified-polyclonal-ab-immunohistochemistry-1732021122114.jpg)
![Immunocytochemistry Nurr1/NGFI-B beta/NR4A2 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2156_human-mouse-nurr1-ngfi-b-beta-nr4a2-affinity-purified-pab-immunocytochemistry-22112021145420.jpg)
![Immunohistochemistry Nurr1/NGFI-B beta/NR4A2 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2156_human-mouse-nurr1-ngfi-b-beta-nr4a2-affinity-purified-pab-immunohistochemistry-10122021111228.jpg)
![Western Blot DLL4 Antibody [Unconjugated]](https://images.novusbio.com/images2/DLL4_AF1389_Western_Blot_15836.jpg)
![Immunocytochemistry DLL4 Antibody [Unconjugated]](https://images.novusbio.com/images2/DLL4_AF1389_Immunocytochemistry_15887.jpg)
![Immunohistochemistry DLL4 Antibody [Unconjugated]](https://images.novusbio.com/images2/DLL4_AF1389_Immunohistochemistry_24173.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")