![Immunohistochemistry-Paraffin: Transgelin/TAGLN/SM22 alpha Antibody [NBP1-87981] - Staining in human smooth muscle and skeletal muscle tissues using anti-TAGLN antibody. Corresponding TAGLN RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Transgelin-TAGLN-SM22-alpha-Antibody-Immunohistochemistry-Paraffin-NBP1-87981-img0016.jpg "Immunohistochemistry-Paraffin: Transgelin/TAGLN/SM22 alpha Antibody [NBP1-87981] - Staining in human smooth muscle and skeletal muscle tissues using anti-TAGLN antibody. Corresponding TAGLN RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQV |
| Predicted Species | Mouse (97%), Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TAGLN |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC reported in scientific literature (PMID: 25706627). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Western_Blot_11082.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11144.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11480.jpg)
| Publication using NBP1-87981 | Applications | Species |
|---|---|---|
| Claudio Isella, Andrea Terrasi, Sara Erika Bellomo et al. Stromal contribution to the colorectal cancer transcriptome. Nature Genetics 2015-02-23 [PMID: 25706627] (IF/IHC, Human) | IF/IHC | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TAGLN |
![Western Blot: Transgelin/TAGLN/SM22 alpha Antibody [NBP1-87981] - Analysis in human heart tissue.](http://images.novusbio.com/fullsize/Transgelin-TAGLN-SM22-alpha-Antibody-Western-Blot-NBP1-87981-img0009.jpg "Western Blot: Transgelin/TAGLN/SM22 alpha Antibody [NBP1-87981] - Analysis in human heart tissue.")
![Immunocytochemistry/Immunofluorescence: Transgelin/TAGLN/SM22 alpha Antibody [NBP1-87981] - Staining of human cell line U-2 OS shows localization to mitochondria & microtubules.](http://images.novusbio.com/fullsize/Transgelin-TAGLN-SM22-alpha-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87981-img0010.jpg "Immunocytochemistry/Immunofluorescence: Transgelin/TAGLN/SM22 alpha Antibody [NBP1-87981] - Staining of human cell line U-2 OS shows localization to mitochondria & microtubules.")
![Immunohistochemistry-Paraffin: Transgelin/TAGLN/SM22 alpha Antibody [NBP1-87981] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/Transgelin-TAGLN-SM22-alpha-Antibody-Immunohistochemistry-Paraffin-NBP1-87981-img0012.jpg "Immunohistochemistry-Paraffin: Transgelin/TAGLN/SM22 alpha Antibody [NBP1-87981] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: Transgelin/TAGLN/SM22 alpha Antibody [NBP1-87981] - Staining of human smooth muscle shows high expression.](http://images.novusbio.com/fullsize/Transgelin-TAGLN-SM22-alpha-Antibody-Immunohistochemistry-Paraffin-NBP1-87981-img0013.jpg "Immunohistochemistry-Paraffin: Transgelin/TAGLN/SM22 alpha Antibody [NBP1-87981] - Staining of human smooth muscle shows high expression.")
![Western Blot Myocardin Antibody (355521) [Unconjugated]](https://images.novusbio.com/images2/Myocardin_MAB4028_Western_Blot_6147.jpg)
![Western Blot Myocardin Antibody (355521) [Unconjugated]](https://images.novusbio.com/images/mab4028_human-mouse-myocardin-mab-clone-355521-412024125217.jpg)
![Western Blot Myocardin Antibody (355521) [Unconjugated]](https://images.novusbio.com/images/mab4028_human-mouse-myocardin-mab-clone-355521-41202412505317.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")