Home » Trace Amine Receptor 1 » Trace Amine Receptor 1 Proteins » Recombinant Human Trace Amine Receptor 1 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human Trace Amine Receptor 1 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human Trace Amine Receptor 1 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-339 of Human TAAR1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNWLIHSMATVDFLLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISIDRYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRGGCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRIYLIAKEQARLISDANQKLQIGLEMKNGISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYIIPPTLNDVLIWFGYLNSTFNPMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
TAAR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
65.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Trace Amine Receptor 1 GST (N-Term) Protein

  • MGC126874
  • MGC138399
  • TA1RP11-295F4.9
  • TAAR1
  • TAR1
  • TaR-1
  • TAR1trace amine-associated receptor 1
  • trace amine associated receptor 1
  • Trace Amine Receptor 1
  • Trace amine receptor 1taR-1
  • TRAR1

Background

TAAR1 is a G protein-coupled receptor activated by trace amines. Trace amines are endogenous amine compounds that account for less than 1% of the biogenic amines in most brain regions (Bunzow et al., 2001 [PubMed 11723224]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(808 Publications)
Species: Hu
Applications: BA
DPPIV/CD26
Antibody [Unconjugate
AF1180
Simple Western DPPIV/CD26 Antibody [Unconjugated]
Immunohistochemistry DPPIV/CD26 Antibody [Unconjugated]
Immunocytochemistry DPPIV/CD26 Antibody [Unconjugated]
(2 Reviews)
(55 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(370 Publications)
Species: Hu
Applications: BA
SLC7A5/LAT1
Antibody (BU53) - BSA
NBP2-50465
Immunohistochemistry-Paraffin SLC7A5/LAT1 Antibody (BU53) - BSA Free
Flow (Cell Surface) SLC7A5/LAT1 Antibody (BU53) - BSA Free
Flow (Cell Surface) SLC7A5/LAT1 Antibody (BU53) - BSA Free
(3 Publications)
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P
GPR151 Antibody -
BSA Free
NLS418
Immunohistochemistry-Paraffin GPR151 Antibody - BSA Free
Immunohistochemistry-Paraffin GPR151 Antibody - BSA Free
Immunohistochemistry-Paraffin GPR151 Antibody - BSA Free
Species: Hu
Applications: IHC, IHC-P
MRGX1 Antibody -
BSA Free
NLS2756
Immunohistochemistry-Paraffin MRGX1 Antibody - BSA Free
Immunohistochemistry-Paraffin MRGX1 Antibody - BSA Free
Immunohistochemistry-Paraffin MRGX1 Antibody - BSA Free
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Lgr6 Antibody
(918719) [Unconjugate
MAB8458
Flow Cytometry Lgr6 Antibody (918719) [Unconjugated]
Immunocytochemistry Lgr6 Antibody (918719) [Unconjugated]
(1 Publication)
Species: Hu
Applications: CyTOF-ready, Flow, ICC
LPAR3/LPA3/EDG-7
Antibody - BSA Free
NLS1017
Immunohistochemistry-Paraffin LPAR3/LPA3/EDG-7 Antibody - BSA Free
Immunohistochemistry-Paraffin LPAR3/LPA3/EDG-7 Antibody - BSA Free
Immunohistochemistry-Paraffin LPAR3/LPA3/EDG-7 Antibody - BSA Free
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
GPRC6A Antibody -
BSA Free
NLS2576
Immunohistochemistry-Paraffin GPRC6A Antibody - BSA Free
Immunohistochemistry-Paraffin GPRC6A Antibody - BSA Free
Immunohistochemistry-Paraffin GPRC6A Antibody - BSA Free
(3 Publications)
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
Frizzled-4
Antibody (145901)
MAB194
Frizzled-4 Antibody (145901)
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
ErbB2/Her2
[Unconjugated]
1129-ER
SDS-PAGE ErbB2/Her2 [Unconjugated]
Bioactivity ErbB2/Her2 [Unconjugated]
(58 Publications)
Species: Hu
Applications: BA
SLC6A3/DAT1
Antibody (mAb16)
NBP2-22164
Western Blot SLC6A3/DAT1 Antibody (mAb16)
Western Blot SLC6A3/DAT1 Antibody (mAb16)
Immunohistochemistry-Paraffin SLC6A3/DAT1 Antibody (mAb16)
(3 Reviews)
(14 Publications)
Species: Hu(-), Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
CD3 Antibody (SP7)
NB600-1441
Immunohistochemistry-Frozen CD3 Antibody (SP7)
Immunohistochemistry-Paraffin CD3 Antibody (SP7)
Immunohistochemistry-Paraffin CD3 Antibody (SP7)
(3 Reviews)
(44 Publications)
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
(1 Review)
(19 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
CD27/TNFRSF7
Antibody [Unconjugate
AF382
Neutralization CD27/TNFRSF7 Antibody [Unconjugated]
Immunohistochemistry CD27/TNFRSF7 Antibody [Unconjugated]
Western Blot CD27/TNFRSF7 Antibody [Unconjugated]
(3 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, Simple Western, WB
Recombinant Human
Trace Amine Receptor ...
H00134864-P01
Recombinant Human Trace Amine Receptor 1 GST (N-Term) Protein
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for Trace Amine Receptor 1 Recombinant Protein (H00134864-P01) (0)

There are no publications for Trace Amine Receptor 1 Recombinant Protein (H00134864-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Trace Amine Receptor 1 Recombinant Protein (H00134864-P01) (0)

There are no reviews for Trace Amine Receptor 1 Recombinant Protein (H00134864-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Trace Amine Receptor 1 Recombinant Protein (H00134864-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Trace Amine Receptor 1 Products

Research Areas for Trace Amine Receptor 1 Recombinant Protein (H00134864-P01)

Find related products by research area.

Blogs on Trace Amine Receptor 1

There are no specific blogs for Trace Amine Receptor 1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
As an alternative, please consider our next generation Recombinant Human IL-2 (BT-002). It has equivalent bioactivity to Recombinant Human IL-2 (Catalog # 202-IL). It combines R&D Systems quality with scalability that allows for a solid supply chain. Both Recombinant Human IL-2 proteins are measured in a cell proliferation assay using CTLL 2 mouse cytotoxic T cells.
IL-2 [Unconjugated]
202-IL-010

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Trace Amine Receptor 1 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol TAAR1