TMPRSS3 Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse TMPRSS3. Peptide sequence: ISPSMLCAGYLKGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVN The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
TMPRSS3 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for TMPRSS3 Antibody
Background
Extracellular proteases mediate the digestion of neighboring extracellular matrix components in initial tumor growth, allow desquamation of tumor cells into the surrounding environment, provide the basis for invasion of basement membranes in targeted metastatic organs and are required for release and activation of many growth and angiogenic factors. The TMPRSS3 (also known as ECHOS1) gene, which encodes a transmembrane serine protease, has been found to be responsible for two non-syndromic recessive deafness loci located on human chromosome 21q22.3, DFNB8 and DFNB10.TMPRSS3, a 437 amno acid membrane bound serine protease and a member of the S1 peptidase family. TMPRSS3 contains an amino-terminal signalanchor sequence and a glycosylated extracellular region containing the serine protease domain. Two novel missense mutations of TMPRSS3, W251C and P404L, alter the highly conserved amino acids of the serine protease domain. TMPRSS3 is expressed in many tissues, including fetal cochlea, a subset of pancreatic cancer and various other cancer tissues. TMPRSS3 is also overexpressed in cancer, suggesting that it may be important for processes in metastasis formation and tumor invasion.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ELISA, S-ELISA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
Publications for TMPRSS3 Antibody (NBP2-86868) (0)
There are no publications for TMPRSS3 Antibody (NBP2-86868).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TMPRSS3 Antibody (NBP2-86868) (0)
There are no reviews for TMPRSS3 Antibody (NBP2-86868).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TMPRSS3 Antibody (NBP2-86868) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TMPRSS3 Products
Research Areas for TMPRSS3 Antibody (NBP2-86868)
Find related products by research area.
|
Blogs on TMPRSS3