Home » TM2D2 » TM2D2 Proteins » TM2D2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

TM2D2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for TM2D2 Protein (NBP2-30462PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

TM2D2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TM2D2.

Source: E. coli

Amino Acid Sequence: TASQELGYGCLKFGGQAYSDVEHTSVQCHALDGIECASPRTFLRENKPCIKYTG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TM2D2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-30462.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TM2D2 Recombinant Protein Antigen

  • BBP-like protein 1
  • Beta-amyloid-binding protein-like protein 1
  • BLP1MGC125814
  • MGC125813
  • TM2 domain containing 2
  • TM2 domain-containing protein 2

Background

TM2D2 is encoded by this gene contains a structural module related to that of the seven transmembrane domain G protein-coupled receptor superfamily. This protein has sequence and structural similarities to the beta-amyloid binding protein (BBP), but, unlike BBP, it does not regulate a response to beta-amyloid peptide. This protein may have regulatory roles in cell death or proliferation signal cascades. This gene has multiple alternatively spliced transcript variants which encode two different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Western Blot c-Myc Antibody (9E10) - BSA Free
(4 Reviews)
(46 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
GPHA2 Antibody
NBP3-17255
Western Blot GPHA2 Antibody
Immunocytochemistry/ Immunofluorescence GPHA2 Antibody
Species: Hu
Applications: ICC/IF, WB
LMOD1 Antibody
NBP1-89396
Immunocytochemistry/ Immunofluorescence LMOD1 Antibody
Immunohistochemistry-Paraffin LMOD1 Antibody
Immunohistochemistry-Paraffin LMOD1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
alpha-Sarcoglycan
Antibody (JA51-81)
NBP2-67150
Immunohistochemistry-Paraffin alpha-Sarcoglycan Antibody (JA51-81)
Immunohistochemistry-Paraffin alpha-Sarcoglycan Antibody (JA51-81)
Immunohistochemistry-Frozen alpha-Sarcoglycan Antibody (JA51-81)
(1 Review)
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NRAS Antibody
(6S6F3)
NBP3-16473
Immunocytochemistry/ Immunofluorescence NRAS Antibody (6S6F3)
Western Blot NRAS Antibody (6S6F3)
Western Blot NRAS Antibody (6S6F3)
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
PCNA Antibody
(PC10)
NB500-106
Immunocytochemistry/ Immunofluorescence PCNA Antibody (PC10)
Western Blot PCNA Antibody (PC10)
Flow Cytometry PCNA Antibody (PC10)
(5 Reviews)
(45 Publications)
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
beta-Catenin
Antibody [Unconjugate
AF1329
Western Blot beta-Catenin Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]
Simple Western beta-Catenin Antibody [Unconjugated]
(2 Reviews)
(33 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
CEBP alpha Antibody
AF7094
Immunohistochemistry CEBP alpha Antibody
Immunocytochemistry/ Immunofluorescence CEBP alpha Antibody
Immunocytochemistry/ Immunofluorescence CEBP alpha Antibody
(1 Publication)
Species: Hu
Applications: IHC
ATP6V0A2 Antibody
NBP1-59069
Western Blot ATP6V0A2 Antibody
Western Blot ATP6V0A2 Antibody
Immunohistochemistry-Paraffin ATP6V0A2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
HRAS Antibody
NBP2-42864
Western Blot HRAS Antibody
Western Blot HRAS Antibody
Western Blot HRAS Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Gankyrin Antibody
(OTI3F6)
NBP2-02199
Flow Cytometry Gankyrin Antibody (OTI3F6)
Flow Cytometry Gankyrin Antibody (OTI3F6)
Western Blot Gankyrin Antibody (OTI3F6)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
BBS9 Antibody
NBP1-88927
Immunohistochemistry-Paraffin BBS9 Antibody
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
TM2D2 Recombinant
Protein Antigen
NBP2-30462PEP
TM2D2 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for TM2D2 Protein (NBP2-30462PEP) (0)

There are no publications for TM2D2 Protein (NBP2-30462PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TM2D2 Protein (NBP2-30462PEP) (0)

There are no reviews for TM2D2 Protein (NBP2-30462PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TM2D2 Protein (NBP2-30462PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TM2D2 Products

Blogs on TM2D2

There are no specific blogs for TM2D2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on U-937 cells with c-Myc Antibody (9E10) NB600-302AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
c-Myc Antibody (9E10) - BSA Free
NB600-302
Immunocytochemistry/Immunofluorescence: PCNA Antibody (PC10) [NB500-106] - HeLa cells were fixed and permeabilized for 10 minutes using cold (-20C) MeOH. The cells were incubated with anti-PCNA [PC10] at 5 ug/mL overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
PCNA Antibody (PC10)
NB500-106

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TM2D2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol TM2D2