Novus Biologicals products are now on bio-techne.com

Recombinant Human Synaptophysin GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Synaptophysin Protein [H00006855-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP, B/N

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Recombinant Human Synaptophysin GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-313 of Human SYP

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGELQLNVDCANKTESDLSIEVEFEYPFRLHQVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDLVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SYP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Block/Neutralize
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Application Notes
Use in blocking / neutralizing and IHC reported in scientific literature (PMID 24786752). Use in ELISA reported in scientific literature (PMID 23371365).
Theoretical MW
60.17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using
H00006855-P01 in the following applications:

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Synaptophysin GST (N-Term) Protein

  • Major synaptic vesicle protein p38
  • MRX
  • MRXSYP
  • Synaptophysin
  • SYP

Background

SYP( AAH64550, 1 a.a. - 314 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-58870
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KD, Simple Western, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NB120-15160
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-00795
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00002023-M01
Species: Fe, Hu
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, WB
AF2408
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
NB300-213
Species: Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
NB300-143
Species: Bv, Ca, Ch, Dr, Eq, Hu, Mu, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
DBD00
Species: Hu
Applications: ELISA
AF3844
Species: Hu, Mu
Applications: IHC
NBP2-67309
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-87102
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P
NB500-517
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-87103
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB

Publications for Synaptophysin Full Length Recombinant Protein (H00006855-P01)(7)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: ELISA, IHC.


Filter By Application
ELISA
(1)
IHC
(1)
All Applications
Filter By Species
Mouse
(2)
All Species
Showing Publications 1 - 7 of 7.
Publications using H00006855-P01 Applications Species
Perez-Rando M, Guirado R, Tellez-Merlo G et al. Estradiol Regulates PSA-NCAM Expression and Connectivity of O-LM Interneurons in The Hippocampus of Adult Female Mice Neuroendocrinology 2021-02-05 [PMID: 33550289]
Rakic S, Hung YMA, Smith M et al. Systemic infection modifies the neuroinflammatory response in late stage Alzheimer's disease. Acta Neuropathol Commun 2018-09-07 [PMID: 30193587]
Guirado R, Carceller H, Castillo-Gomez E et al. Automated analysis of images for molecular quantification in immunohistochemistry. Heliyon. 2018-06-01 [PMID: 30003163] (Mouse) Mouse
Guirado R, Perez-Rando M, Sanchez-Matarredona D et al. Chronic fluoxetine treatment alters the structure, connectivity and plasticity of cortical interneurons. Int. J. Neuropsychopharmacol. 2014-04-30 [PMID: 24786752] (IHC, Mouse) IHC Mouse
Shinohara M, Petersen RC, Dickson DW, Bu G. Brain regional correlation of amyloid-beta with synapses and apolipoprotein E in non-demented individuals: potential mechanisms underlying regional vulnerability to amyloid-beta accumulation. Acta Neuropathol 2013-01-31 [PMID: 23371365] (ELISA) ELISA
Caviness JN, Lue LF, Beach TG et al. Parkinson's disease, cortical dysfunction, and alpha-synuclein. Mov Disord. 2011-05-03 [PMID: 21542019]
Andreyeva A, Leshchyns'ka I, Knepper M et al. CHL1 Is a Selective Organizer of the Presynaptic Machinery Chaperoning the SNARE Complex. PLoS One. 2010-08-11 [PMID: 20711454]

Reviews for Synaptophysin Full Length Recombinant Protein (H00006855-P01) (0)

There are no reviews for Synaptophysin Full Length Recombinant Protein (H00006855-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Synaptophysin Full Length Recombinant Protein (H00006855-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Synaptophysin Products

Research Areas for Synaptophysin Full Length Recombinant Protein (H00006855-P01)

Find related products by research area.

Blogs on Synaptophysin.

Losing memory: Toxicity from mutant APP and amyloid beta explain the hippocampal neuronal damage in Alzheimer's disease
 By Jamshed Arslan Pharm.D.  Alzheimer's disease (AD) is an irreversible brain disorder that destroys memory and thinking skills. The telltale signs of AD brains are extracellular deposits of amy...  Read full blog post.

Synaptophysin a Marker Protein in Neuroendocrine Cells
Synaptophysin a Marker Protein in Neuroendocrine Cells Synaptophysin is a major integral membrane glycoprotein of neuronal synaptic vesicles present in virtually all synapses and shows a high degree of evolutionary conservation across the mammals. Syn...  Read full blog post.

Characterizing Synaptophysin is "a Snap"
Synaptophysin is an integral membrane glycoprotein found within the small synaptic vesicles in brain and endocrine cells. Studies with synaptophysin antibodies show that it is one of the most abundant small vesicle proteins, constituting approximately...  Read full blog post.

Synaptophysin and Dementing Disorders
 Synaptophysin (a presynaptic vesicle protein) is an integral membrane glycoprotein originally isolated from presynaptic vesicles of bovine neurons. Synaptophysin is found in all nerve terminals and synaptophysin measurements have been used to quantif...  Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

MAP2 Antibody
NB300-213
GFAP Antibody
NB300-141

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Synaptophysin GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SYP