![Western Blot: Synapsin II Antibody [NBP2-85854] - Host: Rabbit. Target Name: SYN2. Sample Tissue: Human HeLa Whole Cell lysates. Antibody Dilution: 1ug/ml](http://images.novusbio.com/fullsize/Synapsin-II-Antibody-Western-Blot-NBP2-85854-img0001.jpg "Western Blot: Synapsin II Antibody [NBP2-85854] - Host: Rabbit. Target Name: SYN2. Sample Tissue: Human HeLa Whole Cell lysates. Antibody Dilution: 1ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human Synapsin II. Peptide sequence: QRPLTTQQPQSGTLKDPDSSKTPPQRPPPQGGPGQPQGMQPPGKVLPPRR The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SYN2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Synapsin II Antibody (NBP2-85854)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SYN2 |
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot Complexin-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Complexin-2_AF5085_Western_Blot_5623.jpg)
![Immunocytochemistry Complexin-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Complexin2_AF5085_Immunocytochemistry_13002.jpg)
![Immunocytochemistry Complexin-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/af5085_human-mouse-rat-complexin-2-affinity-purified-polyclonal-ab-immunocytochemistry-284202254030.jpg)
![Immunocytochemistry EGR1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2818_human-egr1-affinity-purified-polyclonal-ab-immunocytochemistry-3102024831..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
