![Western Blot: SUCLG1 Antibody [NBP1-89489] - Analysis using Anti-SUCLG1 antibody NBP1-89489 (A) shows similar pattern to independent antibody NBP2-38318 (B).](http://images.novusbio.com/fullsize/SUCLG1-Antibody-Western-Blot-NBP1-89489-img0014.jpg "Western Blot: SUCLG1 Antibody [NBP1-89489] - Analysis using Anti-SUCLG1 antibody NBP1-89489 (A) shows similar pattern to independent antibody NBP2-38318 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LPQNGIRHCSYTASRQHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGQTHLGLPVFNTVKEAKEQTGA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SUCLG1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-89489 | Applications | Species |
|---|---|---|
| Oyama Y, Bartman CM, Bonney S et al. Intense Light-Mediated Circadian Cardioprotection via Transcriptional Reprogramming of the Endothelium Cell Rep 2019-08-08 [PMID: 31390562] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for SUCLG1 Antibody (NBP1-89489)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SUCLG1 |
![Immunocytochemistry/Immunofluorescence: SUCLG1 Antibody [NBP1-89489] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/SUCLG1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89489-img0009.jpg "Immunocytochemistry/Immunofluorescence: SUCLG1 Antibody [NBP1-89489] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & mitochondria. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human stomach shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/SUCLG1-Antibody-Immunohistochemistry-Paraffin-NBP1-89489-img0022.jpg "Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human stomach shows strong granular cytoplasmic positivity in glandular cells.")
![Western Blot: SUCLG1 Antibody [NBP1-89489] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)](http://images.novusbio.com/fullsize/SUCLG1-Antibody-Western-Blot-NBP1-89489-img0006.jpg "Western Blot: SUCLG1 Antibody [NBP1-89489] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)")
![Western Blot: SUCLG1 Antibody [NBP1-89489] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue](http://images.novusbio.com/fullsize/SUCLG1-Antibody-Western-Blot-NBP1-89489-img0007.jpg "Western Blot: SUCLG1 Antibody [NBP1-89489] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue")
![Western Blot: SUCLG1 Antibody [NBP1-89489] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Mouse Cerebral Cortex tissue](http://images.novusbio.com/fullsize/SUCLG1-Antibody-Western-Blot-NBP1-89489-img0008.jpg "Western Blot: SUCLG1 Antibody [NBP1-89489] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Mouse Cerebral Cortex tissue")
![Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human kidney shows high expression.](http://images.novusbio.com/fullsize/SUCLG1-Antibody-Immunohistochemistry-Paraffin-NBP1-89489-img0010.jpg "Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human kidney shows high expression.")
![Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/SUCLG1-Antibody-Immunohistochemistry-Paraffin-NBP1-89489-img0011.jpg "Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining in human kidney and pancreas tissues using anti-SUCLG1 antibody. Corresponding SUCLG1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SUCLG1-Antibody-Immunohistochemistry-Paraffin-NBP1-89489-img0012.jpg "Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining in human kidney and pancreas tissues using anti-SUCLG1 antibody. Corresponding SUCLG1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human cerebral cortex, colon, kidney and pancreas using Anti-SUCLG1 antibody NBP1-89489 (A) shows similar protein distribution across tissues to independent antibody NBP2-38318 (B).](http://images.novusbio.com/fullsize/SUCLG1-Antibody-Immunohistochemistry-Paraffin-NBP1-89489-img0013.jpg "Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human cerebral cortex, colon, kidney and pancreas using Anti-SUCLG1 antibody NBP1-89489 (A) shows similar protein distribution across tissues to independent antibody NBP2-38318 (B).")
![Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/SUCLG1-Antibody-Immunohistochemistry-Paraffin-NBP1-89489-img0015.jpg "Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human colon.](http://images.novusbio.com/fullsize/SUCLG1-Antibody-Immunohistochemistry-Paraffin-NBP1-89489-img0016.jpg "Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human colon.")
![Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human cerebellum shows strong granular cytoplasmic positivity in cells in granular layer.](http://images.novusbio.com/fullsize/SUCLG1-Antibody-Immunohistochemistry-Paraffin-NBP1-89489-img0017.jpg "Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human cerebellum shows strong granular cytoplasmic positivity in cells in granular layer.")
![Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human cerebellum, fallopian tube, kidney and stomach using Anti-SUCLG1 antibody NBP1-89489 (A) shows similar protein distribution across tissues to independent antibody NBP2-38318 (B).](http://images.novusbio.com/fullsize/SUCLG1-Antibody-Immunohistochemistry-Paraffin-NBP1-89489-img0019.jpg "Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human cerebellum, fallopian tube, kidney and stomach using Anti-SUCLG1 antibody NBP1-89489 (A) shows similar protein distribution across tissues to independent antibody NBP2-38318 (B).")
![Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human Fallopian tube shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/SUCLG1-Antibody-Immunohistochemistry-Paraffin-NBP1-89489-img0020.jpg "Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human Fallopian tube shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/SUCLG1-Antibody-Immunohistochemistry-Paraffin-NBP1-89489-img0021.jpg "Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-89489] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.")
![Flow Cytometry Lgr6 Antibody (918719) [Unconjugated]](https://images.novusbio.com/images2/Lgr6_MAB8458_Flow_Cytometry_16097.jpg)
![Immunocytochemistry Lgr6 Antibody (918719) [Unconjugated]](https://images.novusbio.com/images2/Lgr6_MAB8458_Immunocytochemistry_16415.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Immunohistochemistry Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Endorepellin_AF2364_Immunohistochemistry_6744.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")