![Western Blot: STARD3NL Antibody [NBP1-93527] - Analysis in human cell line U-937 MG.](http://images.novusbio.com/fullsize/STARD3NL-Antibody-Western-Blot-NBP1-93527-img0014.jpg "Western Blot: STARD3NL Antibody [NBP1-93527] - Analysis in human cell line U-937 MG.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MNHLPEDMENALTGSQSSHASLRNIHSINPTQLMARIESYEGREKKGISDVRR |
| Predicted Species | Mouse (92%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | STARD3NL |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Western_Blot_5100.jpg)
![Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Chromatin_Immunoprecipitation_11251.jpg)
![Simple Western beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/betaCatenin_AF1329_Simple_Western_17134.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for STARD3NL Antibody (NBP1-93527)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | STARD3NL |
![Immunocytochemistry/Immunofluorescence: STARD3NL Antibody [NBP1-93527] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/STARD3NL-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-93527-img0007.jpg "Immunocytochemistry/Immunofluorescence: STARD3NL Antibody [NBP1-93527] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: STARD3NL Antibody [NBP1-93527] - Staining of human cerebral cortex shows positivity in neurons.](http://images.novusbio.com/fullsize/STARD3NL-Antibody-Immunohistochemistry-Paraffin-NBP1-93527-img0011.jpg "Immunohistochemistry-Paraffin: STARD3NL Antibody [NBP1-93527] - Staining of human cerebral cortex shows positivity in neurons.")
![Immunohistochemistry-Paraffin: STARD3NL Antibody [NBP1-93527] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize/STARD3NL-Antibody-Immunohistochemistry-Paraffin-NBP1-93527-img0004.jpg "Immunohistochemistry-Paraffin: STARD3NL Antibody [NBP1-93527] - Staining of human liver shows low expression as expected.")
![Immunohistochemistry-Paraffin: STARD3NL Antibody [NBP1-93527] - Staining of human placenta shows high expression.](http://images.novusbio.com/fullsize/STARD3NL-Antibody-Immunohistochemistry-Paraffin-NBP1-93527-img0005.jpg "Immunohistochemistry-Paraffin: STARD3NL Antibody [NBP1-93527] - Staining of human placenta shows high expression.")
![Immunohistochemistry-Paraffin: STARD3NL Antibody [NBP1-93527] - Staining in human placenta and liver tissues using anti-STARD3NL antibody. Corresponding STARD3NL RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/STARD3NL-Antibody-Immunohistochemistry-Paraffin-NBP1-93527-img0006.jpg "Immunohistochemistry-Paraffin: STARD3NL Antibody [NBP1-93527] - Staining in human placenta and liver tissues using anti-STARD3NL antibody. Corresponding STARD3NL RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: STARD3NL Antibody [NBP1-93527] - Staining of human prostate shows positivity in glandular cells.](http://images.novusbio.com/fullsize/STARD3NL-Antibody-Immunohistochemistry-Paraffin-NBP1-93527-img0010.jpg "Immunohistochemistry-Paraffin: STARD3NL Antibody [NBP1-93527] - Staining of human prostate shows positivity in glandular cells.")
![SDS-PAGE TRANCE/TNFSF11/RANK L [Unconjugated]](https://images.novusbio.com/images2/TRANCE_462-TEC_442.jpg)
![Bioactivity TRANCE/TNFSF11/RANK L [Unconjugated]](https://images.novusbio.com/images2/TRANCE_462-TEC_556.jpg)
![N/A Osteoprotegerin/TNFRSF11B [Biotin]](https://images.novusbio.com/images2/DATA_Osteoprotegerin_DY805_ELISA_2238.jpg)
![LRP-5 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "LRP-5 [Unconjugated]")
![N/A Corin [Biotin]](https://images.novusbio.com/images2/DATA_Corin_DY2209_ELISA_1787.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")