Novus Biologicals products are now on bio-techne.com

SRGAP2 Recombinant Protein Antigen

Name: SRGAP2 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-89013PEP
Price: 279 USD

Images

There are currently no images for SRGAP2 Protein (NBP1-89013PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SRGAP2 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SRGAP2. Source: E. coli Amino Acid Sequence: LEPLKTSPVVAPTSEPSSPLHTQLLKDPEPAFQRSASTAGDIACAFRPVKSVKMAAPVKPPATRPKPTVFPKTNATSPGVNSSTSPQST Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	SRGAP2
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89013. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SRGAP2 Recombinant Protein Antigen

FNBP2
Formin-binding protein 2
KIAA0456ARHGAP34formin binding protein 2
Rho GTPase-activating protein 34
SLIT-ROBO Rho GTPase activating protein 2
SLIT-ROBO Rho GTPase-activating protein 2
srGAP2
SRGAP3

Background

SRGAP2, also known as SLIT-ROBO Rho GTPase-activating protein 2, is a 121 kDa 1071 amino acid protein. Throughout the development of the cerebral cortex SRGAP2 has a significant role in neuronal morphogenesis. Current research on SRGAP2 is being conducted in relation to neuronitis, pilocytic astrocytoma, infantile epileptic encephalopathy and schizophrenia. SRGAP2 is linked to the long-term memory, axon guidance, localization, brain development and cell migration pathways where it interacts with FASLG, YWHAG, YWHAZ, DISC1 and MYO1G.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SRGAP1 Antibody
(5D2)

H00057522-M03

(2 Publications)

Species: Hu, Pm, Rt

Applications: ELISA, IHC, IHC-P, WB

ARHGAP4 Antibody

NBP1-88527

Immunohistochemistry-Paraffin ARHGAP4 Antibody

(1 Publication)

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

ARHGAP1 Antibody

NBP1-85724

(1 Publication)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Cip4 Antibody

NBP3-38370

Immunocytochemistry/ Immunofluorescence Cip4 Antibody

Species: Hu, Mu

Applications: ELISA, ICC/IF, WB

FNBP1 Antibody

NBP2-48542

Species: Hu

Applications: IHC, IHC-P, WB

DLC1 Antibody -
Isoform 1 and 3

NB300-917

Immunohistochemistry-Paraffin DLC1 Antibody - Isoform 1 and 3

(2 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P

Rhodopsin Antibody
(4D2)

NBP2-59690

Immunohistochemistry Rhodopsin Antibody (4D2)

(1 Review)

(6 Publications)

Species: Am, Av, Fi, Ma, Ze

Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB

RhoD Antibody

NBP1-58359

Species: Hu

Applications: IHC, IHC-P, WB

ARHGAP17 Antibody

NBP1-83870

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

FCHSD2 Antibody

NBP1-81479

Species: Hu

Applications: ICC/IF, IHC, IHC-P

AKT [p Ser473]
Antibody [Unconjugate ...

AF887

Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific

Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific

(50 Publications)

Species: Hu, Mu, Rt

Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB

Chimaerin 2
Antibody

NBP3-12294

Species: Hu, Mu, Rt

Applications: ELISA, IHC, IHC-P, IP, WB

CHN 1 Antibody
(OTI2G6) - Azide and ...

NBP2-70411

Immunocytochemistry/ Immunofluorescence CHN 1 Antibody (OTI2G6) - Azide and BSA Free

Immunohistochemistry CHN 1 Antibody (OTI2G6) - Azide and BSA Free

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

NORE1 Antibody -
BSA Free

NB500-248

(2 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Phenylalanine
Hydroxylase Antibody

NBP2-48615

(1 Publication)

Species: Hu

Applications: IHC, IHC-P, WB

FMNL1 Antibody

NBP1-88461

Species: Hu

Applications: IHC, IHC-P

FMN1 Antibody (4F4)

H00342184-M07

Immunocytochemistry/ Immunofluorescence FMN1 Antibody (4F4)

Species: Hu

Applications: ELISA, ICC/IF, WB

ARHGAP20 Antibody

NBP2-24757

Immunohistochemistry-Paraffin ARHGAP20 Antibody

Species: Hu, Pm

Applications: IHC, IHC-P, WB

GRAF Antibody

NBP1-89732

(2 Publications)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

SRGAP2 Recombinant
Protein Antigen

NBP1-89013PEP

Species: Hu

Applications: AC

Publications for SRGAP2 Protein (NBP1-89013PEP) (0)

There are no publications for SRGAP2 Protein (NBP1-89013PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SRGAP2 Protein (NBP1-89013PEP) (0)

There are no reviews for SRGAP2 Protein (NBP1-89013PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SRGAP2 Protein (NBP1-89013PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SRGAP2 Products

Blogs on SRGAP2

There are no specific blogs for SRGAP2, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunohistochemistry-Frozen: Rhodopsin Antibody (4D2) [NBP2-59690] - Zebrafish retina (outer nuclear layer). PFA and methanol fixed 7 um sections. Rhodopsin antibody O/N incubation at 1:500. IHC-Fr image submitted by a verified customer review.

Rhodopsin Antibody (4D2)
NBP2-59690-100ug

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our SRGAP2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

SRGAP2

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

SRGAP2 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

SRGAP2 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for SRGAP2 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for SRGAP2 Protein (NBP1-89013PEP) (0)

Reviews for SRGAP2 Protein (NBP1-89013PEP) (0)

FAQs for SRGAP2 Protein (NBP1-89013PEP) (0)

Additional SRGAP2 Products

Blogs on SRGAP2

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics