Reactivity | HuSpecies Glossary |
Applications | WB, ELISA, MA, AP |
Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 801-900 of Human SREBP2 Source: Wheat Germ (in vitro) Amino Acid Sequence: QAFCKNLLERAIESLVKPQAKKKAGDQEEESCEFSSALEYLKLLHSFVDSVGVMSPPLSRSSVLKSALGPDIICRWWTSAITVAISWLQGDDAAVRSHFT |
Preparation Method |
in vitro wheat germ expression system |
Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
Source | Wheat germ |
Protein/Peptide Type | Partial Recombinant Protein |
Gene | SREBF2 |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Dilutions |
|
Theoretical MW | 36.63 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Storage | Store at -80C. Avoid freeze-thaw cycles. |
Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Preservative | No Preservative |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
SREBP2 - regulating cholesterol homeostasis and lipid metabolism Sterol regulatory element-binding proteins (SREBP) are important transcription factors regulating the synthesis and uptake of lipids including cholesterol. This essential role in lipid metabolism makes investigations into the functions SREBPs im... Read full blog post. |
SREBP: Gatekeeper of Cholesterol Homeostasis SREBP1 (sterol-regulatory-element-binding protein 2) is a basic-helix-loop-helix-leucine zipper (bHLH-ZIP) transcription factor. It regulates sterol and cholesterol homeostasis by controlling enzymes involved in cholesterol synthesis and uptake, e.g. ... Read full blog post. |
SREBPs: Global Regulator of Lipid Metabolism Sterol regulatory element binding proteins (SREBPs) are indirectly required for cholesterol biosynthesis and for uptake and fatty acid biosynthesis. There are three known SREBP isoforms, SREBP1a, 1c and SREBP2; these have different roles in lipid synt... Read full blog post. |
SREBP2: From Cholesterol Homeostasis to Cancer Invasion Sterol-regulatory-element-binding protein 2 (SREBP2) is a transcription factor that regulates cholesterol homeostasis by controlling enzymes involved in cholesterol synthesis and uptake, e.g. HMG-CoA. Along with another transcription factor LXR, SREBP... Read full blog post. |
ABCA1 Expression is Down-Regulated by SREBP microRNA The ABCA1 (ATP-binding cassette transporter-A1) gene encodes a transmembrane protein, which plays a major role in phospholipid homeostasis by regulating cholesterol efflux from the cell. ABCA1 antibody studies have shown ABCA1 expression is up/down re... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | SREBF2 |