Novus Biologicals products are now on bio-techne.com

SOX3 Antibody (CL4725) [DyLight 755]

Name: SOX3 Antibody (CL4725) [DyLight 755]
Brand: Novus Biologicals
SKU: NBP2-59060IR

Images

There are currently no images for SOX3 Antibody (NBP2-59060IR).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	WB
Clone	CL4725
Clonality	Monoclonal
Host	Mouse
Conjugate	DyLight 755

Order Details

View Available Conjugates

Catalog# & Conjugate	Size	Price
Alexa Fluor 350 NBP2-59060AF350

Alexa Fluor 405 NBP2-59060AF405

Alexa Fluor 488 NBP2-59060AF488

Alexa Fluor 532 NBP2-59060AF532

Alexa Fluor 594 NBP2-59060AF594

Alexa Fluor 647 NBP2-59060AF647

Alexa Fluor 700 NBP2-59060AF700

Alexa Fluor 750 NBP2-59060AF750

Allophycocyanin NBP2-59060APC

Biotin NBP2-59060B

CoraFluor 1 NBP2-59060CL1

DyLight 350 NBP2-59060UV

DyLight 405 NBP2-59060V

DyLight 488 NBP2-59060G

DyLight 550 NBP2-59060R

DyLight 594 NBP2-59060DL594

DyLight 650 NBP2-59060C

DyLight 680 NBP2-59060FR

FITC NBP2-59060F

HRP NBP2-59060H

Janelia Fluor 525 NBP2-59060JF525

Janelia Fluor 549 NBP2-59060JF549

Janelia Fluor 585 NBP2-59060JF585

Janelia Fluor 635 NBP2-59060JF635

Janelia Fluor 646 NBP2-59060JF646

Janelia Fluor 669 NBP2-59060JF669

PE NBP2-59060PE

PerCP NBP2-59060PCP

Unconjugated NBP2-59060

mFluor Violet 450 SE NBP2-59060MFV450

mFluor Violet 500 SE NBP2-59060MFV500

mFluor Violet 610 SE NBP2-59060MFV610

View Available Formulations

Catalog# & Formulation	Size	Price
Standard Formulation NBP2-59060

Azide and BSA Free NBP3-44124

Novus Biologicals offers 100% Guarantee

Conjugate	Catalog #	Availability	Size	Price
Alexa Fluor 350	NBP2-59060AF350
Alexa Fluor 405	NBP2-59060AF405
Alexa Fluor 488	NBP2-59060AF488
Alexa Fluor 532	NBP2-59060AF532
Alexa Fluor 594	NBP2-59060AF594
Alexa Fluor 647	NBP2-59060AF647
Alexa Fluor 700	NBP2-59060AF700
Alexa Fluor 750	NBP2-59060AF750
Allophycocyanin	NBP2-59060APC
Biotin	NBP2-59060B
CoraFluor 1	NBP2-59060CL1
DyLight 350	NBP2-59060UV
DyLight 405	NBP2-59060V
DyLight 488	NBP2-59060G
DyLight 550	NBP2-59060R
DyLight 594	NBP2-59060DL594
DyLight 650	NBP2-59060C
DyLight 680	NBP2-59060FR
FITC	NBP2-59060F
HRP	NBP2-59060H
Janelia Fluor 525	NBP2-59060JF525
Janelia Fluor 549	NBP2-59060JF549
Janelia Fluor 585	NBP2-59060JF585
Janelia Fluor 635	NBP2-59060JF635
Janelia Fluor 646	NBP2-59060JF646
Janelia Fluor 669	NBP2-59060JF669
PE	NBP2-59060PE
PerCP	NBP2-59060PCP
Unconjugated	NBP2-59060
mFluor Violet 450 SE	NBP2-59060MFV450
mFluor Violet 500 SE	NBP2-59060MFV500
mFluor Violet 610 SE	NBP2-59060MFV610

SOX3 Antibody (CL4725) [DyLight 755] Summary

Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RENSSGARSPRVPADLARSILISLPFPPDSLAHRPPSSAPTESQGLFTVAAPAPGAPSPPATLAHLLPAPAMYSLLETELKNPVGTPTQAAGTGGPAAPGGAGKSSA
Isotype	IgG1
Clonality	Monoclonal
Host	Mouse
Gene	SOX3
Purity	Protein A purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Applications/Dilutions

Dilutions	Western Blot
Application Notes	Optimal dilution of this antibody should be experimentally determined.

Reactivity Notes

Expected to cross react based on sequence identity: Mouse 82%.

Packaging, Storage & Formulations

Storage	Store at 4C in the dark.
Buffer	50mM Sodium Borate
Preservative	0.05% Sodium Azide
Purity	Protein A purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for SOX3 Antibody (CL4725) [DyLight 755]

GHDX
MRGH
panhypopituitarism
PHP
PHPX
SOX3
SOXB
SRY (sex determining region Y)-box 3
transcription factor SOX-3

Background

SOX3 encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. Mutations in this gene have been associated with X-linked mental retardation with growth hormone deficiency.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PTH Antibody
(918462) [Unconjugate

MAB7665

Western Blot PTH Antibody (918462) [Unconjugated]

Species: Hu

Applications: IHC, WB

SOX2 Antibody
[Unconjugated]

AF2018

Chromatin Immunoprecipitation (ChIP) SOX2 Antibody [Unconjugated]

Simple Western SOX2 Antibody [Unconjugated]

(6 Reviews)

(379 Publications)

Species: Hu, Mu, Rt

Applications: ChIP, ICC, IHC, Simple Western, WB

PTRH1 Antibody

NBP1-86713

Species: Hu

Applications: IHC, IHC-P

G protein alpha
Antibody (2A2B7) - BS ...

NBP2-52477

Flow Cytometry G protein alpha Antibody (2A2B7) - BSA Free

Immunohistochemistry G protein alpha Antibody (2A2B7) - BSA Free

(1 Publication)

Species: Hu

Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB

Lipoprotein
Lipase/LPL Antibody [ ...

AF7197

Western Blot Lipoprotein Lipase/LPL Antibody [Unconjugated]

Immunocytochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]

(12 Publications)

Species: Hu, Mu

Applications: ICC, IHC, WB

SOX1 Antibody
[Unconjugated]

AF3369

Simple Western SOX1 Antibody [Unconjugated]

Immunocytochemistry SOX1 Antibody [Unconjugated]

(141 Publications)

Species: Hu, Mu, Rt

Applications: ICC, IHC, Simple Western, WB

LIPC Antibody -
BSA Free

NBP3-04922

Species: Hu

Applications: ICC/IF, WB

HESX1 Antibody

NBP1-89090

Species: Hu

Applications: IHC, IHC-P

Plastin L Antibody

NBP2-19860

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

SOX9 Antibody
[Unconjugated]

AF3075

Western Blot SOX9 Antibody [Unconjugated]

(2 Reviews)

(155 Publications)

Species: Hu

Applications: ICC, Simple Western, WB

Growth Hormone
Antibody [Unconjugate

AF1067

ELISA Growth Hormone Antibody [Unconjugated]

Neutralization Growth Hormone Antibody [Unconjugated]

(15 Publications)

Species: Hu, Mu, Rt

Applications: ELISA, IHC, Neut, WB

Growth Hormone
Antibody [Unconjugate

AF1067

(15 Publications)

Species: Hu, Mu, Rt

Applications: ELISA, IHC, Neut, WB

gamma-glutamyl
hydrolase Antibody

NBP1-90927

Immunohistochemistry-Paraffin gamma-glutamyl hydrolase Antibody

(1 Publication)

Species: Hu

Applications: IHC, IHC-P, WB

Lhx4 Antibody

NBP3-38503

Species: Hu, Mu, Rt

Applications: ELISA, IHC, IHC-P, WB

Otx2 Antibody
[Unconjugated]

AF1979

Immunohistochemistry Otx2 Antibody [Unconjugated]

Simple Western Otx2 Antibody [Unconjugated]

(2 Reviews)

(180 Publications)

Species: Hu

Applications: ICC, IHC, Simple Western, WB

Oct-3/4 Antibody
[Unconjugated]

AF1759

Immunocytochemistry Oct-3/4 Antibody [Unconjugated]

Simple Western Oct-3/4 Antibody [Unconjugated]

(77 Publications)

Species: Hu, Mu

Applications: ChIP, ICC, IP, Simple Western, WB

Pax6 Antibody
[Unconjugated]

AF8150

Immunocytochemistry Pax6 Antibody [Unconjugated]

Western Blot Pax6 Antibody [Unconjugated]

(16 Publications)

Species: Hu

Applications: ICC, ICFlow, Simple Western, WB

SOX3 Antibody
(CL4725) [DyLight 755

NBP2-59060IR

Species: Hu

Applications: WB

Publications for SOX3 Antibody (NBP2-59060IR) (0)

There are no publications for SOX3 Antibody (NBP2-59060IR).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SOX3 Antibody (NBP2-59060IR) (0)

There are no reviews for SOX3 Antibody (NBP2-59060IR). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SOX3 Antibody (NBP2-59060IR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

Isotype Controls

Additional SOX3 Products

Blogs on SOX3

There are no specific blogs for SOX3, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western blot shows lysates of D3 mouse embryonic stem cell line, NTera-2 human testicular embryonic carcinoma cell line, F9 mouse teratocarcinoma stem cells, and rat cortical stem cells. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat SOX2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2018) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (HAF017). A specific band was detected for SOX2 at approximately 36 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.

SOX2 Antibody [Unconjugated]
AF2018

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our SOX3 Antibody (CL4725) [DyLight 755] and receive a gift card or discount.

Bioinformatics

Gene Symbol

SOX3

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

SOX3 Antibody (CL4725) [DyLight 755]

Species Glossary

Images

Product Details

Order Details

SOX3 Antibody (CL4725) [DyLight 755] Summary

Applications/Dilutions

Reactivity Notes

Packaging, Storage & Formulations

Notes

Alternate Names for SOX3 Antibody (CL4725) [DyLight 755]

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for SOX3 Antibody (NBP2-59060IR) (0)

Reviews for SOX3 Antibody (NBP2-59060IR) (0)

Product General Protocols

Video Protocols

FAQs for SOX3 Antibody (NBP2-59060IR) (0)

Secondary Antibodies

Isotype Controls

Additional SOX3 Products

Blogs on SOX3

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics