Novus Biologicals products are now on bio-techne.com

Recombinant Human SOS2 GST (N-Term) Protein

Name: Recombinant Human SOS2 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00006655-Q01
Price: 589 USD

Submit a Review

Images

(

Enlarge)

12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	WB, ELISA, MA, AP

Order Details

Novus Biologicals offers 100% Guarantee

Recombinant Human SOS2 GST (N-Term) Protein Summary

Description	A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 312-420 of Human SOS2 Source: Wheat Germ (in vitro) Amino Acid Sequence: LMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLKACSEEQEDRECLNQAITALMNHQGSMDRIYKQYSPRRRPGDPVCPFYSHQLRSKHLAIKKM
Preparation Method	in vitro wheat germ expression system
Details of Functionality	This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source	Wheat germ
Protein/Peptide Type	Recombinant Protein
Gene	SOS2
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	ELISA Immunoaffinity Purification Protein Array Western Blot
Theoretical MW	37.73 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -80C. Avoid freeze-thaw cycles.
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SOS2 GST (N-Term) Protein

FLJ25596
guanine nucleotide exchange factor
guanine nucleotide releasing factor
son of sevenless (Drosophilia) homolog 2
son of sevenless homolog 2 (Drosophila)
son of sevenless homolog 2
SOS2
SOS-2

Background

SOS2 - son of sevenless homolog 2 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

GEF-H1 Antibody

NBP2-21577

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB

SLC2A4RG Antibody
(4C10) - Azide and BS ...

H00056731-M02

Immunocytochemistry/ Immunofluorescence SLC2A4RG Antibody (4C10) - Azide and BSA Free

Species: Hu

Applications: ELISA, ICC/IF, WB

AKT [p Ser473]
Antibody [Unconjugate ...

AF887

Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific

Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific

(50 Publications)

Species: Hu, Mu, Rt

Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB

CDC42 Antibody
(JJ086-04)

NBP2-67895

Immunohistochemistry-Paraffin CDC42 Antibody (JJ086-04)

Species: Hu, Mu, Rt

Applications: Flow, IHC, IHC-P, IP, WB

Rac1 Antibody

NB100-91266

(1 Review)

(5 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

Vav-1 [p Tyr160]
Antibody (751411) [Un ...

MAB37861

Western Blot Vav-1 [p Tyr160] Antibody (751411) [Unconjugated]

Immunocytochemistry Vav-1 [p Tyr160] Antibody (751411) [Unconjugated]

(1 Publication)

Species: Hu

Applications: ICC, Simple Western, WB

Rhodopsin Antibody
(B630)

NBP2-25160

Immunocytochemistry/ Immunofluorescence Rhodopsin Antibody (B630)

(10 Publications)

Species: Bv, Ca, Eq, Hu, Mu, Po, Rt

Applications: ICC/IF, IHC, WB

RhoD Antibody -
BSA Free

NBP1-58359

Immunohistochemistry RhoD Antibody - BSA Free

Species: Hu

Applications: IHC, IHC-P, WB

RhoA Antibody

NB100-91273

Immunohistochemistry-Paraffin RhoA Antibody

(1 Review)

(6 Publications)

Species: Hu, Mu, Pm, Rt

Applications: ICC/IF, IHC, IHC-P, WB

SOS1 Antibody
(SOS-01) - BSA Free

NB110-68800

Immunocytochemistry/ Immunofluorescence SOS1 Antibody (SOS-01) - BSA Free

Species: Hu, Mu

Applications: ICC/IF, WB

ERK2 Antibody
[Unconjugated]

AF1230

Immunohistochemistry ERK2 Antibody [Unconjugated]

Knockout Validated ERK2 Antibody [Unconjugated]

(3 Publications)

Species: Hu, Mu, Rt

Applications: IHC, KO, WB

RASGRF1 Antibody

NBP3-13291

Immunohistochemistry-Paraffin RASGRF1 Antibody

Species: Mu, Rt

Applications: WB

RAPGEF3 Antibody -
BSA Free

NBP2-81767

Immunohistochemistry RAPGEF3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence RAPGEF3 Antibody - BSA Free

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Rabex5 Antibody -
BSA Free

NBP1-49938

Immunohistochemistry-Paraffin Rabex5 Antibody - BSA Free

(2 Publications)

Species: Hu, Mu

Applications: IHC, IHC-P, IP, WB

GRB2 Antibody
[Unconjugated]

AF3846

Immunohistochemistry GRB2 Antibody [Unconjugated]

(2 Publications)

Species: Hu, Mu, Rt

Applications: IHC, WB

Pleckstrin Antibody

NB100-1343

(2 Publications)

Species: Hu

Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB

Rap1A/B Antibody
[Unconjugated]

AF3767

Immunohistochemistry Rap1A/B Antibody [Unconjugated]

(4 Publications)

Species: Hu, Mu, Rt

Applications: IHC, WB

EGF [Unconjugated]

236-EG

(864 Publications)

Species: Hu

Applications: BA

Src [p Tyr419]
Antibody [Unconjugate

AF2685

Simple Western Src [p Tyr419] Antibody [Unconjugated]

Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]

(1 Review)

(10 Publications)

Species: Hu

Applications: IHC, Simple Western, WB

Recombinant Human
SOS2 GST (N-Term) Pro ...

H00006655-Q01

Species: Hu

Applications: WB, ELISA, MA, AP

Publications for SOS2 Partial Recombinant Protein (H00006655-Q01) (0)

There are no publications for SOS2 Partial Recombinant Protein (H00006655-Q01).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SOS2 Partial Recombinant Protein (H00006655-Q01) (0)

There are no reviews for SOS2 Partial Recombinant Protein (H00006655-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SOS2 Partial Recombinant Protein (H00006655-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SOS2 Products

Research Areas for SOS2 Partial Recombinant Protein (H00006655-Q01)

Find related products by research area.

Blogs on SOS2

There are no specific blogs for SOS2, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our Recombinant Human SOS2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol

SOS2

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Recombinant Human SOS2 GST (N-Term) Protein

Species Glossary

Images

Product Details

Order Details

Recombinant Human SOS2 GST (N-Term) Protein Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for Recombinant Human SOS2 GST (N-Term) Protein

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for SOS2 Partial Recombinant Protein (H00006655-Q01) (0)

Reviews for SOS2 Partial Recombinant Protein (H00006655-Q01) (0)

Product General Protocols

Video Protocols

FAQs for SOS2 Partial Recombinant Protein (H00006655-Q01) (0)

Additional SOS2 Products

Research Areas for SOS2 Partial Recombinant Protein (H00006655-Q01)

Blogs on SOS2

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics