Home » SMARCC1 » SMARCC1 Proteins » Recombinant Human SMARCC1 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human SMARCC1 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human SMARCC1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 338-437 of Human SMARCC1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: ESRKKSGKKGQASLYGKRRSQKEEDEQEDLTKDMEDPTPVPNIEEVVLPKNVNLKKDSENTPVKGGTVADLDEQDEETVTAGGKEDEDPAKGDQSRSVDL
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SMARCC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SMARCC1 GST (N-Term) Protein

  • BAF155SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily C member 1
  • BRG1-associated factor 155
  • chromatin remodeling complex BAF155 subunit
  • CRACC1
  • mammalian chromatin remodeling complex BRG1-associated factor 155
  • Rsc8
  • SRG3
  • subfamily c, member 1
  • SWI/SNF complex 155 kDa subunit
  • SWI/SNF complex subunit SMARCC1
  • SWI/SNF related, matrix associated, actin dependent regulator of chromatin
  • SWI3

Background

SMARCC1 - SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Brg1 Antibody
[Unconjugated]
AF5738
Western Blot Brg1 Antibody [Unconjugated]
Immunocytochemistry Brg1 Antibody [Unconjugated]
Immunocytochemistry Brg1 Antibody [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, KO, WB
SMARCA1 Antibody
(2H7B8) - BSA Free
NBP2-61879
ELISA SMARCA1 Antibody (2H7B8) - BSA Free
Flow Cytometry SMARCA1 Antibody (2H7B8) - BSA Free
Immunohistochemistry SMARCA1 Antibody (2H7B8) - BSA Free
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
SNF5 Antibody
(3E10)
H00006598-M01
ELISA SNF5 Antibody (3E10)
Immunohistochemistry-Paraffin SNF5 Antibody (3E10)
Western Blot SNF5 Antibody (3E10)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
BRM Antibody
NBP3-13283
Immunohistochemistry-Paraffin BRM Antibody
Immunohistochemistry-Paraffin BRM Antibody
Immunocytochemistry/ Immunofluorescence BRM Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
SMARCC2/BAF170
Antibody
NBP1-90017
Immunocytochemistry/ Immunofluorescence SMARCC2/BAF170 Antibody
Western Blot SMARCC2/BAF170 Antibody
Immunohistochemistry-Paraffin SMARCC2/BAF170 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
SMARCD1 Antibody
NBP1-88719
Immunocytochemistry/ Immunofluorescence SMARCD1 Antibody
Western Blot SMARCD1 Antibody
Immunohistochemistry-Paraffin SMARCD1 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
BAF57 Antibody
NBP1-90012
Immunocytochemistry/ Immunofluorescence BAF57 Antibody
Immunohistochemistry-Paraffin BAF57 Antibody
Immunohistochemistry-Paraffin BAF57 Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
BANF1 Antibody
(3F10-4G12)
H00008815-M01
Immunohistochemistry-Paraffin BANF1 Antibody (3F10-4G12)
Western Blot BANF1 Antibody (3F10-4G12)
Sandwich ELISA BANF1 Antibody (3F10-4G12)
(6 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
HDAC1 Antibody
NB100-56340
Knockout Validated HDAC1 Antibody
Simple Western HDAC1 Antibody
Western Blot HDAC1 Antibody
(2 Reviews)
(19 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
COCO/DAND5
[Unconjugated]
3047-CC
COCO/DAND5 [Unconjugated]
(4 Publications)
Species: Hu
Applications: BA
PSG1 [HRP]
DPSG10
N/A PSG1 [HRP]
N/A PSG1 [HRP]
(2 Publications)
Species: Hu
Applications: ELISA
SP1 Antibody
NB600-232
Western Blot SP1 Antibody
Immunohistochemistry-Paraffin SP1 Antibody
Western Blot SP1 Antibody
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
GR/NR3C1 Antibody
(BuGR2) - BSA Free
NB300-731
Flow Cytometry GR/NR3C1 Antibody (BuGR2) - BSA Free
Flow Cytometry GR/NR3C1 Antibody (BuGR2) - BSA Free
Immunocytochemistry/ Immunofluorescence GR/NR3C1 Antibody (BuGR2) - BSA Free
(3 Reviews)
(12 Publications)
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
SMARCD3 Antibody
(1G6)
H00006604-M01
Immunocytochemistry/ Immunofluorescence SMARCD3 Antibody (1G6)
Western Blot SMARCD3 Antibody (1G6)
Sandwich ELISA SMARCD3 Antibody (1G6)
(3 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, S-ELISA, WB
ARID1A Antibody
NBP1-88932
Western Blot ARID1A Antibody
Immunohistochemistry-Paraffin ARID1A Antibody
Immunohistochemistry-Paraffin ARID1A Antibody
(23 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
KLF1 Antibody
(1B6A3) - BSA Free
NBP2-37380
ELISA KLF1 Antibody (1B6A3) - BSA Free
Western Blot KLF1 Antibody (1B6A3) - BSA Free
Flow Cytometry KLF1 Antibody (1B6A3) - BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Oct-3/4 Antibody
[Unconjugated]
AF1759
Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]
Immunocytochemistry Oct-3/4 Antibody [Unconjugated]
Simple Western Oct-3/4 Antibody [Unconjugated]
(77 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB

Publications for SMARCC1 Partial Recombinant Protein (H00006599-Q01) (0)

There are no publications for SMARCC1 Partial Recombinant Protein (H00006599-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMARCC1 Partial Recombinant Protein (H00006599-Q01) (0)

There are no reviews for SMARCC1 Partial Recombinant Protein (H00006599-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SMARCC1 Partial Recombinant Protein (H00006599-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SMARCC1 Products

Array H00006599-Q01

Research Areas for SMARCC1 Partial Recombinant Protein (H00006599-Q01)

Find related products by research area.

Blogs on SMARCC1

There are no specific blogs for SMARCC1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Knockout Validated: HDAC1 Antibody [NB100-56340] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and HDAC1 knockout (KO) HeLa cell line. PVDF membrane was probed with 2.0 ug/ml of Rabbit Anti-Human HDAC1 Polyclonal Antibody (Catalog # NB100-56340) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for HDAC1 at approximately 65 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
HDAC1 Antibody
NB100-56340

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SMARCC1 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol SMARCC1