| Reactivity | HuSpecies Glossary |
| Applications | AC |
| Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC34A1 Source: E. coli Amino Acid Sequence: KLIIQLDESVITSIATGDESLRNHSLIQIWCHPDSLQAPTSMSRAEANSSQTLGNATMEKCNHIFVDTGLP Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source | E. coli |
| Protein/Peptide Type | Recombinant Protein Antigen |
| Gene | SLC34A1 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Application Notes | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17792. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW | 25 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
![Immunohistochemistry PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Immunohistochemistry_16650.jpg)
![Western Blot PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Western_Blot_16656.jpg)
Research Areas for SLC34A1 Recombinant Protein Antigen (NBP3-17792PEP)Find related products by research area.
|
|
SLC34A1 - major regulator of inorganic phosphate (Pi) homeostasis SLC34A1 encodes the 69 kDa sodium-dependent phosphate transport protein 2A (Npt2a). SLC34A is a member of the type II sodium-phosphate co-transporter family, along with SLC34A3 which encodes Npt2c. These proteins are abundantly expressed along the... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC34A1 |
![Immunohistochemistry FGF-23 Antibody (283507) [Unconjugated]](https://images.novusbio.com/images2/FGF23_MAB26291_Immunohistochemistry_17626.jpg)
![Immunohistochemistry FGF-23 Antibody (283507) [Unconjugated]](https://images.novusbio.com/images/mab26291_mouse-fgf-23-mab-clone-283507-41202412512640.jpg)
![Western Blot FGF-23 Antibody (283507) [Unconjugated]](https://images.novusbio.com/images/mab26291_mouse-fgf-23-mab-clone-283507-41202412514876.jpg)
![Western Blot Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Western_Blot_17309.jpg)
![Simple Western Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Immunocytochemistry__Immunofluorescence_17494.jpg)
![Immunocytochemistry Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Immunocytochemistry_11973.jpg)
![Immunohistochemistry Klotho Antibody [Unconjugated]](https://images.novusbio.com/images2/Klotho_AF1819_Immunohistochemistry_6720.jpg)
![Western Blot Klotho Antibody [Unconjugated]](https://images.novusbio.com/images2/Klotho_AF1819_Western_Blot_22658.jpg)
![ELISA Klotho Antibody [Unconjugated]](https://images.novusbio.com/images2/Klotho_AF1819_ELISA_22841.jpg)
![Flow Cytometry: SLC34A1 Antibody (10B1.3E9) [NBP2-42216] - An intracellular stain was performed on Hek293 cells with SLC34A1 Antibody [10B1.3E9] NBP2-42216AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.](https://images.novusbio.com/images/SLC34A1-Antibody-10B1-3E9-Flow-Cytometry-NBP2-42216-img0008.jpg "Flow Cytometry: SLC34A1 Antibody (10B1.3E9) [NBP2-42216] - An intracellular stain was performed on Hek293 cells with SLC34A1 Antibody [10B1.3E9] NBP2-42216AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.")