Home » SART3 » SART3 Proteins » SART3 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SART3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SART3 Recombinant Protein Antigen (NBP3-17928PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SART3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SART3

Source: E. coli

Amino Acid Sequence: LSINVYDYNCHVDLIRLLRLEGELTKVRMARQKMSEIFPLTEELWLEWLHDEISMAQDGLDREHVYDLFEKAVKDYICPNIWLEYGQYSVGGIGQKGGLEKVRSVFERALSSVGL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SART3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17928.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SART3 Recombinant Protein Antigen

  • DSAP1
  • hSART-3
  • KIAA0156squamous cell carcinoma antigen recognised by T cells 3
  • P100
  • p110
  • p110(nrb)
  • RP11-13G14
  • SART-3
  • squamous cell carcinoma antigen recognized by T cells 3
  • squamous cell carcinoma antigen recognized by T-cells 3
  • Tat-interacting protein of 110 kDa
  • Tip110
  • TIP110MGC138188

Background

SART3 is encoded by this gene is an RNA-binding nuclear protein that is a tumor-rejection antigen. This antigen possesses tumor epitopes capable of inducing HLA-A24-restricted and tumor-specific cytotoxic T lymphocytes in cancer patients and may be useful for specific immunotherapy. This gene product is found to be an important cellular factor for HIV-1 gene expression and viral replication. It also associates transiently with U6 and U4/U6 snRNPs during the recycling phase of the spliceosome cycle. This encoded protein is thought to be involved in the regulation of mRNA splicing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
ARHGEF7 Antibody
NBP1-88650
Western Blot ARHGEF7 Antibody
Immunohistochemistry-Paraffin ARHGEF7 Antibody
Immunohistochemistry-Paraffin ARHGEF7 Antibody
Species: Hu
Applications: IHC, IHC-P, KD, WB
NFkB2/NFkB p100
Antibody
NBP1-87760
Immunohistochemistry-Paraffin NFkB2/NFkB p100 Antibody
Immunohistochemistry-Paraffin NFkB2/NFkB p100 Antibody
Immunohistochemistry-Paraffin NFkB2/NFkB p100 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
PI 3-Kinase p110
beta/PIK3CB Antibody ...
MAB2686
Western Blot PI 3-Kinase p110 beta/PIK3CB Antibody (269020)
(5 Publications)
Species: Hu
Applications: WB
PI 3-Kinase p85
alpha Antibody (A3-D0
NBP2-67058
Flow Cytometry PI 3-Kinase p85 alpha Antibody (A3-D0)
Immunocytochemistry/ Immunofluorescence PI 3-Kinase p85 alpha Antibody (A3-D0)
Immunocytochemistry/ Immunofluorescence PI 3-Kinase p85 alpha Antibody (A3-D0)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
PI 3-Kinase p85
beta Antibody (572001 ...
MAB6777
Western Blot PI 3-Kinase p85 beta Antibody (572001) [Unconjugated]
Immunocytochemistry PI 3-Kinase p85 beta Antibody (572001) [Unconjugated]
(2 Publications)
Species: Hu
Applications: ICC, WB
MTGR1 Antibody
NBP2-34136
Western Blot MTGR1 Antibody
Immunohistochemistry-Paraffin MTGR1 Antibody
Immunohistochemistry-Paraffin MTGR1 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
ASPP1 Antibody
NBP1-90078
Immunohistochemistry-Paraffin ASPP1 Antibody
Western Blot ASPP1 Antibody
Western Blot ASPP1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PI 3-Kinase p110
delta Antibody (OTI1D ...
NBP2-46404
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
(1 Review)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
PI 3-Kinase p110
gamma Antibody
NBP2-15071
Western Blot PI 3-Kinase p110 gamma Antibody
Western Blot PI 3-Kinase p110 gamma Antibody
Immunohistochemistry-Paraffin PI 3-Kinase p110 gamma Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
PIK3CA Antibody
NBP2-19804
Western Blot PIK3CA Antibody
Immunohistochemistry-Paraffin PIK3CA Antibody
Western Blot PIK3CA Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
LEDGF Antibody
(762815) [Unconjugate
MAB3468
Western Blot LEDGF Antibody (762815) [Unconjugated]
Immunocytochemistry LEDGF Antibody (762815) [Unconjugated]
(1 Review)
(1 Publication)
Species: Hu
Applications: ICC, WB
GTF2H4 Antibody
H00002968-B01P
Western Blot GTF2H4 Antibody
Immunocytochemistry/ Immunofluorescence GTF2H4 Antibody
Species: Hu
Applications: ICC/IF, WB
FKBP52/FKBP4
Antibody (5C11)
H00002288-M01
ELISA FKBP52/FKBP4 Antibody (5C11)
Western Blot FKBP52/FKBP4 Antibody (5C11)
Immunohistochemistry-Paraffin FKBP52/FKBP4 Antibody (5C11)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
CD40/TNFRSF5
Antibody [Unconjugate
AF632
Agonist Activity CD40/TNFRSF5 Antibody [Unconjugated]
Western Blot CD40/TNFRSF5 Antibody [Unconjugated]
Simple Western CD40/TNFRSF5 Antibody [Unconjugated]
(7 Publications)
Species: Hu
Applications: AgAct, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(809 Publications)
Species: Hu
Applications: BA
ASCC1 Antibody
(OTI6G5)
NBP2-01345
Flow Cytometry ASCC1 Antibody (OTI6G5)
Flow Cytometry ASCC1 Antibody (OTI6G5)
Western Blot ASCC1 Antibody (OTI6G5)
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Human, Mouse, Rat
RelA/NFkB p65 ELISA K ...
NBP2-29661
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
(95 Publications)
Species: Hu, Mu, Rt
Applications: ELISA
CDP/CUTL1 Antibody
(2A10)
H00001523-M01
Western Blot CDP/CUTL1 Antibody (2A10)
Immunohistochemistry-Paraffin CDP/CUTL1 Antibody (2A10)
ELISA CDP/CUTL1 Antibody (2A10)
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB

Publications for SART3 Recombinant Protein Antigen (NBP3-17928PEP) (0)

There are no publications for SART3 Recombinant Protein Antigen (NBP3-17928PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SART3 Recombinant Protein Antigen (NBP3-17928PEP) (0)

There are no reviews for SART3 Recombinant Protein Antigen (NBP3-17928PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SART3 Recombinant Protein Antigen (NBP3-17928PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SART3 Products

Blogs on SART3

There are no specific blogs for SART3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SART3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SART3