Novus Biologicals products are now on bio-techne.com

RUNX2/CBFA1 Antibody (3F5)

Images

 
Western Blot: RUNX2/CBFA1 Antibody (3F5) [H00000860-M06] - Western Blot analysis of RUNX2 expression in Hela NE ( Cat # L012V1 ).
Immunocytochemistry/ Immunofluorescence: RUNX2/CBFA1 Antibody (3F5) [H00000860-M06] - Analysis of monoclonal antibody to RUNX2 on U-2 OS cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody (3F5) [H00000860-M06] - Analysis of monoclonal antibody to RUNX2 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml
Immunocytochemistry/ Immunofluorescence: RUNX2/CBFA1 Antibody (3F5) [H00000860-M06] - Immunofluorescence of monoclonal antibody to RUNX2 on U-2 OS cell . [antibody concentration 10 ug/ml]
ELISA: RUNX2/CBFA1 Antibody (3F5) [H00000860-M06] - Detection limit for recombinant GST tagged RUNX2 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, Func, ICC/IF, IHC, ChIP
Clone
3F5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RUNX2/CBFA1 Antibody (3F5) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
RUNX2 (NP_004339, 251 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGA
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RUNX2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Chromatin Immunoprecipitation (ChIP)
  • ELISA
  • Functional
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA. Use in Immunohistochemistry reported in scientific literature (PMID: 27055270).
Theoretical MW
56.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using H00000860-M06.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RUNX2/CBFA1 Antibody (3F5)

  • Acute myeloid leukemia 3 protein
  • CBFA1
  • CBF-alpha-1
  • CCD1
  • CCDAML3
  • CLCD
  • Core-binding factor subunit alpha-1
  • core-binding factor, runt domain, alpha subunit 1
  • MGC120023
  • ML3
  • oncogene AML-3
  • OSF2
  • OSF-2
  • osteoblast-specific transcription factor 2
  • PEA2aA
  • PEA2-alpha A
  • PEBP2A
  • PEBP2aA
  • PEBP2-alpha A
  • polyomavirus enhancer-binding protein 2 alpha A subunit
  • runt domain, alpha subunit 1
  • runt related transcription factor 2
  • runt-related transcription factor 2
  • RUNX2
  • SL3/AKV core-binding factor alpha A subunit
  • SL3-3 enhancer factor 1 alpha A subunit

Background

Runt-related transcription factor 2 (RUNX2), also known as CBFA1, AML-3, PEBP-2alphaA, and OSF-2, is a transcription factor that places a critical role in osteoblast differentiation and bone development (1-3). RUNX2 is a DNA-binding protein that belongs to the RUNX family which share a common runt domain (3). RUNX2 has two main isoforms which vary based on the two promoter regions (3). The main canonical isoform (P1) has MASN/DS at its N-terminus while the other (P2) isoform includes a MRIPV pentapeptide at its N-terminus (3). The RUNX2 P1 isoform has a theoretical molecular weight of 56 kDa and is synthesized as a 521 amino acid (aa) protein containing multiple domains. Specifically, RUNX2 contains transactivation domains (AD1, 2 and 3), a glutamine/alanine (Q/A)-rich domain, a runt homology domain (RHD), a nuclear localization signal (NLS), a proline/serine/threonine (PST)-rich domain, a nuclear matrix targeting signal (NMTS), a repression domain (RD), and a VWRPY region (3). RUNX2 is a heterodimer of an alpha and beta subunit where the alpha subunit binds DNA through the runt domain and the binding affinity is increased through heterodimerization (4).

Functionally, RUNX2 promotes the expression of osteoblast-specific genes vital for the osteoblast differentiation and proliferation process including type I collagen, osteocalcin (OCN), and alkaline phosphatase (APC) (1, 3). Further evidence for the role of RUNX2 is highlighted by a study of Runx2-/-mice which completely lack osteoblasts (4). Additionally, RUNX2 is also required for chondrocyte maturation, which are the cells responsible for cartilage formation (1, 3, 5). Given the role of RUNX2 in bone and cartilage maturation and formation, it is clear that defects or mutations in RUNX2 cause various bone and bone-related diseases (3, 6, 7). For instance, cleidocranial dysplasia (CCD), which presents with delayed cranial suture closure phenotypes, hypoplastic clavicles, extra teeth, and short stature, is caused by haploinsufficiency in RUNX2 (2, 3, 6). Furthermore, metaphyseal dysplasia with maxillary hypoplasia and brachydactyly (MDMHB) is a bone dysplasia disorder with a phenotype of abnormalities in the long bones, an underdeveloped jawbone, and short fingers that is caused by a duplication in RUNX2 (6). Finally, RUNX2 has been shown to be upregulated in mouse models of the joint disorder osteoarthritis (OA) and may be a potential molecular target for disease treatment (7).

Alternative names for RUNX2 include Acute myeloid leukemia 3 protein CBFA1, CBF-alpha-1, CCD1, CCDAML3, CLCD, Core-binding factor subunit alpha-1, MGC120023, ML3, oncogene AML-3, OSF2, osteoblast-specific transcription factor 2, PEA2aA, PEA2-alpha A, PEBP2A, polyomavirus enhancer-binding protein 2 alpha A subunit, runt related transcription factor 2, SL3/AKV core-binding factor alpha A subunit, and SL3-3 enhancer factor 1 alpha A subunit.

References

1. Ferreira, L. B., Gimba, E., Vinagre, J., Sobrinho-Simoes, M., & Soares, P. (2020). Molecular Aspects of Thyroid Calcification. International journal of molecular sciences. https://doi.org/10.3390/ijms21207718

2. Kim, W. J., Shin, H. L., Kim, B. S., Kim, H. J., & Ryoo, H. M. (2020). RUNX2-modifying enzymes: therapeutic targets for bone diseases. Experimental & molecular medicine. https://doi.org/10.1038/s12276-020-0471-4

3. Vimalraj, S., Arumugam, B., Miranda, P. J., & Selvamurugan, N. (2015). Runx2: Structure, function, and phosphorylation in osteoblast differentiation. International journal of biological macromolecules. https://doi.org/10.1016/j.ijbiomac.2015.04.008

4. Uniprot (Q13950)

5. Komori T. (2017). Roles of Runx2 in Skeletal Development. Advances in experimental medicine and biology. https://doi.org/10.1007/978-981-10-3233-2_6

6. Moffatt, P., Ben Amor, M., Glorieux, F. H., Roschger, P., Klaushofer, K., Schwartzentruber, J. A., Paterson, A. D., Hu, P., Marshall, C., FORGE Canada Consortium, Fahiminiya, S., Majewski, J., Beaulieu, C. L., Boycott, K. M., & Rauch, F. (2013). Metaphyseal dysplasia with maxillary hypoplasia and brachydactyly is caused by a duplication in RUNX2. American journal of human genetics. https://doi.org/10.1016/j.ajhg.2012.12.001

7. Chen, D., Kim, D. J., Shen, J., Zou, Z., & O'Keefe, R. J. (2019). Runx2 plays a central role in Osteoarthritis development. Journal of orthopaedic translation. https://doi.org/10.1016/j.jot.2019.11.008

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
355-BM
Species: Hu, Mu, Rt
Applications: BA
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
MAB7547
Species: Hu
Applications: ICC, WB
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
DCC270
Species: Hu
Applications: ELISA
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-25358
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
DPI00
Species: Hu
Applications: ELISA
NBP2-32263
Species: Hu, Mu
Applications: IHC, IP, WB
AF4014
Species: Hu
Applications: WB
DY805
Species: Hu
Applications: ELISA
355-BM
Species: Hu, Mu, Rt
Applications: BA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-89105
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
462-TR
Species: Mu
Applications: BA
MAB7665
Species: Hu
Applications: IHC, WB
AF3075
Species: Hu
Applications: ICC, Simple Western, WB
H00000860-M06
Species: Hu, Rt
Applications: WB, ELISA, Func, ICC/IF, IHC, ChIP

Publications for RUNX2/CBFA1 Antibody (H00000860-M06)(8)

We have publications tested in 1 application: IF/IHC.


Filter By Application
IF/IHC
(1)
All Applications
Filter By Species
All Species
Showing Publications 1 - 8 of 8.
Publications using H00000860-M06 Applications Species
Carr FE, Tai PW, Barnum MS et al. Thyroid Hormone Receptor-beta (TRbeta) Mediates Runt-Related Transcription Factor 2 (Runx2) Expression in Thyroid Cancer Cells: A Novel Signaling Pathway in Thyroid Cancer. Endocrinology 2016-08-01 [PMID: 27253998]
Bleil J, Maier R, Hempfing A et al. Granulation Tissue Eroding the Subchondral Bone Also Promotes New Bone Formation in Ankylosing Spondylitis. Arthritis Rheumatol 2016-04-25 [PMID: 27111225]
Gruber HE, Ode G, Hoelscher G et al. Osteogenic, stem cell and molecular characterisation of the human induced membrane from extremity bone defects. Bone Joint Res 2016-04-01 [PMID: 27056768]
Sonomoto K, Yamaoka K, Kaneko H et al. Spontaneous Differentiation of Human Mesenchymal Stem Cells on Poly-Lactic-Co-Glycolic Acid Nano-Fiber Scaffold. PLoS One 2016-04-07 [PMID: 27055270] (IF/IHC) IF/IHC
Niu DF, Kondo T, Nakazawa T et al. Transcription factor Runx2 is a regulator of epithelial-mesenchymal transition and invasion in thyroid carcinomas. Lab Invest. 2012-05-28 [PMID: 22641097]
Li X, Zhou L, Takai H et al. Aggregatibacter actinomycetemcomitans lipopolysaccharide regulates bone sialoprotein gene transcription. J Cell Biochem. 2012-04-10 [PMID: 22492284]
Li Z, Sasaki Y, Mezawa M et al. cAMP and fibroblast growth factor 2 regulate bone sialoprotein gene expression in human prostate cancer cells. Gene;471(1-2):1-12. 2011-01-15 [PMID: 20965237]
Wang Z, Li X, Li Z et al. Effects of inorganic polyphosphate on bone sialoprotein gene expression. Gene. 2010-01-07 [PMID: 20060443]

Reviews for RUNX2/CBFA1 Antibody (H00000860-M06) (0)

There are no reviews for RUNX2/CBFA1 Antibody (H00000860-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RUNX2/CBFA1 Antibody (H00000860-M06). (Showing 1 - 2 of 2 FAQs).

  1. We would like an anti-RUNX2 for IHC-P which share cross reactivity with Rat, but not with Human.
    • We don't have any data for our RUNX2 antibodies that confirms they will NOT detect the human protein. When we can confirm that an antibody will not react with a certain species, we display a (-) sign on the datasheet. Otherwise, if the species is not listed it means that it has not been tested.
  2. We ordered this antibodies (RUNX2 3F5) a few months ago for IHC-P and western blot. From the datasheet, it seems to be no reference or publications for this antibodies usage in western blot. We have to try to run it for western blot by using a denatured protein, but we couldn't get any band for this RUNX2 protein. May I know does the western blot indicated in the datasheet was tested in denatured or nature protein lysate ?
    • I assume that you are inquiring about our RUNX2 antibody, H00000860-M06, which we distribute for Abnova. Abnova conducts all of their development and testing, and we are not involved in this process. It does appear that H00000860-M06 was tested in western blot on HeLa cell nuclear extracts in order to create the image provided with this product.

Secondary Antibodies

 

Isotype Controls

Additional RUNX2/CBFA1 Products

Research Areas for RUNX2/CBFA1 Antibody (H00000860-M06)

Find related products by research area.

Blogs on RUNX2/CBFA1

There are no specific blogs for RUNX2/CBFA1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RUNX2/CBFA1 Antibody (3F5) and receive a gift card or discount.

Bioinformatics

Gene Symbol RUNX2
Entrez
OMIM
Uniprot